Home
Products
Primary Antibodies
Recombinant Antibodies
NCAM1/CD56 Recombinant monoclonal antibody (82715-3-RR)

NCAM1/CD56 Recombinant monoclonal antibody

NCAM1/CD56 Uni-rAb^® Recombinant Antibody for IHC, IF-P, ELISA

Cat No. 82715-3-RR

Clone No. 5N5

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

CD56, NCAM1, MSK39, N CAM 1, NCAM

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHC-AutostainerIHCIF-PAffinity

IHC staining of human tonsillitis using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pituitary adenoma using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82715-3-RR (NCAM1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82715-3-RR (NCAM1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82715-3-RR (NCAM1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82715-3-RR (NCAM1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pituitary adenoma using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 82715-3-RR
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 82715-3-RR (NCAM1/CD56 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 82715-3-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using NCAM1/CD56 antibody (82715-3-RR, Clone: 5N5 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 82715-3-RR
Biolayer interferometry (BLl) kinetic assays of 82715-3-RR against Human NCAM1/CD56 were performed. The affinity constant is 1.45 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NCAM1/CD56 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	human tonsillitis tissue, human kidney tissue, human tonsillitis tissue, human liver tissue, human lymphoma tissue, human appendicitis tissue, human pituitary adenoma tissue, human colon cancer tissue, human stomach cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human tonsillitis tissue

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
Immunofluorescence (IF)-P	IF-P : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82715-3-RR targets NCAM1/CD56 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag5528 Product name: Recombinant human NCAM1/CD56 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 30-352 aa of BC047244 Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE Predict reactive species
Full Name	neural cell adhesion molecule 1
Calculated Molecular Weight	95 kDa
GenBank Accession Number	BC047244
Gene Symbol	NCAM1
Gene ID (NCBI)	4684
ENSEMBL Gene ID	ENSG00000149294
RRID	AB_3670537
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P13591
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isoforms have also been described (PMID: 1856291).