NCAM1/CD56 Recombinant monoclonal antibody, PBS Only

NCAM1/CD56 Uni-rAb® Recombinant Antibody for IHC, IF-P, Indirect ELISA
Cat No. 82715-3-PBS
Clone No.5N5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, Indirect ELISA

CD56, NCAM1, 5N5, MSK39, N CAM 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82715-3-PBS targets NCAM1/CD56 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5528

Product name: Recombinant human NCAM1/CD56 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-352 aa of BC047244

Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE

Predict reactive species
Full Name neural cell adhesion molecule 1
Calculated Molecular Weight 95 kDa
GenBank Accession NumberBC047244
Gene Symbol NCAM1
Gene ID (NCBI) 4684
ENSEMBL Gene IDENSG00000149294
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13591
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isoforms have also been described (PMID: 1856291).

Loading...
||
New chat

Able

正在加载,请稍候...