Tested Applications
| Positive WB detected in | C6 cells, HT-1080 cells, PC-3 cells, PC-12 cells |
| Positive IP detected in | C6 cells |
| Positive IHC detected in | human stomach cancer tissue, mouse kidney tissue, rat stomach tissue, human placenta tissue, human stomach cancer tissue, rat kidney tissue, mouse stomach tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13690-1-AP targets NEDD4L in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4565 Product name: Recombinant human NEDD4L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 565-911 aa of BC032597 Sequence: EESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD Predict reactive species |
| Full Name | neural precursor cell expressed, developmentally down-regulated 4-like |
| Calculated Molecular Weight | 854 aa, 96 kDa |
| Observed Molecular Weight | 112 kDa, 125 kDa |
| GenBank Accession Number | BC032597 |
| Gene Symbol | NEDD4L |
| Gene ID (NCBI) | 23327 |
| RRID | AB_2149326 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96PU5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEDD4L(E3 ubiquitin-protein ligase NEDD4-like) is also named as KIAA0439, NEDL3, Nedd4-2. It accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substratesand and is the principal ubiquitin ligase that selectively targets activated SMAD2 and SMAD3 for destruction (PMID:19917253). Nedd4L binds the PY motif of ENaC COOH terminals and catalyzes ubiquitination of the NH2 terminus of the protein for subsequent degradation (PMID:18268134). It has some isoforms produced by alternative splicing. This antibody may have cross reaction with NEDD4 due to the high homology of the antigen.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NEDD4L antibody 13690-1-AP | Download protocol |
| IHC protocol for NEDD4L antibody 13690-1-AP | Download protocol |
| IP protocol for NEDD4L antibody 13690-1-AP | Download protocol |
| WB protocol for NEDD4L antibody 13690-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-NEDD4L antibody (Cat# 13690-1-AP) has accumulated 72 citations in prestigious journals including Nature Genetics, Nature Communications, Advanced Science, Cell Death & Differentiation, Theranostics, FASEB Journal, and Journal of Hepatology. Key research fields include oncology (hepatocellular, lung, breast, gastric, and colorectal cancers), ferroptosis, ubiquitin-mediated protein degradation, neurology, cardiology, liver fibrosis, diabetic kidney disease, exosome biology, and stress granule phase separation.
| Species | Application | Title |
|---|---|---|
J Hepatol eIF3f promotes tumour malignancy by remodelling fatty acid biosynthesis in hepatocellular carcinoma | ||
Cancer Commun (Lond) Cytoplasmic YAP1-mediated ESCRT-III assembly promotes autophagic cell death and is ubiquitinated by NEDD4L in breast cancer | ||
Nat Genet Mutations in the HECT domain of NEDD4L lead to AKT-mTOR pathway deregulation and cause periventricular nodular heterotopia. | ||
Nat Commun Endothelial major vault protein alleviates vascular remodeling via promoting Parkin-mediated mitophagy | ||
Nat Commun Munc13-4 mediates tumor immune evasion by regulating the sorting and secretion of PD-L1 via exosomes. | ||
Nat Commun Stress granule phase separation in stress-responsive cytosolic extract-in-oil droplets. |
Reviews
What customers say
Based on available reviews, 13690-1-AP has received positive feedback. One reviewer reported using it for Western Blot on mouse ventricular whole lysate at a 1:800 dilution, noting that the antibody performed as expected with minimal non-specific staining and awarded it a 5-star rating. Overall, the limited review data suggests reliable performance in WB applications with good specificity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Andrew (Verified Customer) (07-23-2025) | This antibody worked as advertised with little to no non-specific staining
|
