• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Use Able AI chat for product recommendations
Filter:
  • Western Blot (WB) analysis of various lysates using NEDD9 Recombinant antibody (83362-2-RR)

    WB analysis using 83362-2-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 83362-2-RR (NEDD9 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using NEDD9 Recombinant antibody (83362-2-RR)

    WB analysis using 83362-2-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 83362-2-RR (NEDD9 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of HepG2 cells using NEDD9 Recombinant antibody (83362-2-RR)

    WB analysis of HepG2 using 83362-2-RR

    WB result of NEDD9 antibody (83362-2-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NEDD9 transfected HepG2 cells.

  • Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using NEDD9 Recombinant antibody (83362-2-RR)

    IF Staining of MCF-7 using 83362-2-RR

    Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using NEDD9 antibody (83362-2-RR, Clone: 240310F8 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  • Immunofluorescence (IF) / fluorescent staining of A549 cells using NEDD9 Recombinant antibody (83362-2-RR)

    IF Staining of A549 using 83362-2-RR

    Immunofluorescent analysis of (4% PFA) fixed A549 cells using NEDD9 antibody (83362-2-RR, Clone: 240310F8 ) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

  • Affinity and Kinetic Characterization of 83362-2-RR

    Affinity and Kinetic Characterization of 83362-2-RR

    Biolayer interferometry (BLl) kinetic assays of 83362-2 against Human NEDD9 were performed. The affinity constant is 0.173 nM.

  • Featured Product
  • KD/KO Validated

NEDD9 Recombinant monoclonal antibody

NEDD9 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 83362-2-RR
Clone No.240310F8

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

HEF1, Enhancer of filamentation 1 p55, CRK-associated substrate-related protein, CAS-L, CASL

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inA549 cells, HepG2 cells, MCF-7 cells, U-251 cells, Raji cells, Jurkat cells
Positive IF/ICC detected inMCF-7 cells, A549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83362-2-RR targets NEDD9 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34170

Product name: Recombinant human NEDD9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 227-458 aa of BC040207

Sequence: PSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELF

Predict reactive species
Full Name neural precursor cell expressed, developmentally down-regulated 9
Calculated Molecular Weight 834 aa, 93 kDa
Observed Molecular Weight 105 kDa, 115 kDa
GenBank Accession NumberBC040207
Gene Symbol NEDD9
Gene ID (NCBI) 4739
RRIDAB_3671016
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14511
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEDD9, also known as CASL, HEF1, contains an N-terminal Src homology (SH) 3 domain and an adjacent domain composed of multiple SH2-binding motifs(PMID: 8668148). Cell cycle-regulated processing produces four isoforms: p115, p105, p65, and p55. Isoform p115 arises from p105 phosphorylation and appears later in the cell cycle. Isoform p55 arises from p105 as a result of cleavage at a caspase cleavage-related site and it appears specifically at mitosis. p105 and p115 are predominantly cytoplasmic and associated with focal adhesions, whereas p55associates with the mitotic spindle(PMID: 9584194).

Protocols

Product Specific Protocols
IF protocol for NEDD9 antibody 83362-2-RRDownload protocol
WB protocol for NEDD9 antibody 83362-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...