iNOS Polyclonal antibody

iNOS Polyclonal Antibody for WB, FC (Intra), ELISA
Cat No. 22226-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment

NOS2, EC:1.14.13.39, Hepatocyte NOS, HEP-NOS, Inducible NO synthase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, RAW 264.7 cells
Positive FC (Intra) detected inLPS treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22226-1-AP targets iNOS in WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17567

Product name: Recombinant human NOS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-190 aa of BC130283

Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFAT

Predict reactive species
Full Name nitric oxide synthase 2, inducible
Calculated Molecular Weight 1153 aa, 131 kDa
Observed Molecular Weight 110-130 kDa, 65-70 kDa
GenBank Accession NumberBC130283
Gene Symbol iNOS
Gene ID (NCBI) 4843
RRIDAB_2879038
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35228
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOS2, also named as iNOS and NOS2A, produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission, antimicrobial and antitumoral activities. NOS2 is a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. iNOS has a very short half-life due to rapid degradation by calpain. iNOS monomer is a direct substrate of calpain I and can be cleaved by calpain I at the canonical CaM-binding site(503-532aa) of iNOS, and then a ~70kD band can be detected by western (PMID:11786228).

Protocols

Product Specific Protocols
WB protocol for iNOS antibody 22226-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Theranostics

Multifunctionally disordered TiO2 nanoneedles prevent periprosthetic infection and enhance osteointegration by killing bacteria and modulating the osteoimmune microenvironment

Authors - Yangmengfan Chen
mouse,humanWB,IHC

Mol Ther

Epsin1-mediated exosomal sorting of Dll4 modulates the tubular-macrophage crosstalk in diabetic nephropathy

Authors - Jia-Lu Liu
mouseIF

Proc Natl Acad Sci U S A

Sleep deficiency exacerbates periodontal inflammation via trigeminal TRPV1 neurons

Authors - Junhui Li
mouseWB,IF

J Nanobiotechnology

Injectable photocrosslinking spherical hydrogel-encapsulated targeting peptide-modified engineered exosomes for osteoarthritis therapy

Authors - Junlai Wan
mouseIHC

Cancer Lett

Inducible nitric oxide synthase (iNOS)-activated Cxcr2 signaling in myeloid cells promotes TGFβ-dependent squamous cell carcinoma lung metastasis

Authors - Xing Li
mouseWB

Acta Biomater

Black Phosphorus Nanosheets Promote Neuronal Differentiation of Neural Stem Cells through Adhesion and Pinocytosis for Spinal Cord Injury Repair

Authors - Lu Chen
Loading...
||
New chat Able
正在加载,请稍候...