OAS1 Recombinant monoclonal antibody

OAS1 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 82883-1-RR

Clone No.2H4

Publications(2)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

(2-5')oligo(A) synthase 1, 2-5A synthase 1, 2'-5'-oligoadenylate synthase 1, E18/E16, EC:2.7.7.84

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCFC (Intra)Affinity

WB analysis using 82883-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 82883-1-RR (OAS1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of A549 using 82883-1-RR
A549 cells were subjected to SDS PAGE followed by western blot with 82883-1-RR (OAS1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 82883-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 82883-1-RR (OAS1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 82883-1-RR
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 82883-1-RR (OAS1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse spleen using 82883-1-RR
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 82883-1-RR (OAS1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse spleen using 82883-1-RR
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 82883-1-RR (OAS1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 82883-1-RR
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 82883-1-RR (OAS1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HeLa using 82883-1-RR
1x10^6 HeLa cells were intracellularly stained with 0.25 ug OAS1 Recombinant antibody (82883-1-RR, Clone:2H4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 82883-1-RR
Biolayer interferometry (BLl) kinetic assays of 82883-1-RR against Human OAS1 were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	IFN alpha treated HeLa cells, A549 cells, HeLa cells, HT-29 cells
Positive IHC detected in	mouse liver tissue, mouse spleen tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive FC (Intra) detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunohistochemistry (IHC)	IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82883-1-RR targets OAS1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag6793 Product name: Recombinant human OAS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000562 Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPA Predict reactive species
Full Name	2',5'-oligoadenylate synthetase 1, 40/46kDa
Calculated Molecular Weight	46 kDa
Observed Molecular Weight	38 kDa
GenBank Accession Number	BC000562
Gene Symbol	OAS1
Gene ID (NCBI)	4938
RRID	AB_3670601
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P00973
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS1, are interferon-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS1 (type I enzymes) has some isoforms with the MW of 40, 42, 44, 46, and 48 kDa (PMID:12590567, 19383565). OAS1 is a strong candidate for determining susceptibility or resistance to viral infections(PMID:15732009).

Protocols

Product Specific Protocols
FC protocol for OAS1 antibody 82883-1-RR	Download protocol
IHC protocol for OAS1 antibody 82883-1-RR	Download protocol
WB protocol for OAS1 antibody 82883-1-RR	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

All (2)

Species	Application	Title
		Phytomedicine Bufalin mitigates corneal damage in herpes simplex keratitis mice via inhibiting viral replication. Authors - Jing Wu View Article
		EMBO J RNA helicase SKIV2L limits antiviral defense and autoinflammation elicited by the OAS-RNase L pathway Authors - Kun Yang View Article