CDKN2A/P16-INK4A Recombinant monoclonal antibody

CDKN2A/P16-INK4A Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 81373-10-RR
Clone No.241438B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

P16, p16 INK4, P16 INK4A, p16INK4A, P16-INK4A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, TF-1 cells
Positive IHC detected inhuman cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81373-10-RR targets CDKN2A/P16-INK4A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1328

Product name: Recombinant human P16-INK4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-156 aa of BC021998

Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 2A
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC021998
Gene Symbol CDKN2A
Gene ID (NCBI) 1029
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P16-INK4A is also named as CDKN2A, MLM, Tumor suppressor ARF, Alternative reading frame. The tumor suppressor protein p16Ink4a (encoded from the CDKN2A locus) is often transcriptionally activated in cells undergoing senescence and is one of the main regulators of this program, and it is upregulated in multiple tissues during aging (PMID:17055429). p16-Ink4a is the principal member of the Ink4 family of CDK inhibitors. p16-Ink4a contributes to the regulation of cell cycle progression by inhibiting the S phase. p16Ink4a binds to CDK4/6, inhibiting cyclin D-CDK4/6 complex formation and CDK4/6-mediated phosphorylation of Rb family members. Expression of p16-Ink4a maintains the Rb family members in a hypophosphorylated state, which promotes binding to E2F1 and leads to G1 cell cycle arrest (PMID: 21297668).

Protocols

Product Specific Protocols
IF protocol for CDKN2A/P16-INK4A antibody 81373-10-RRDownload protocol
IHC protocol for CDKN2A/P16-INK4A antibody 81373-10-RRDownload protocol
WB protocol for CDKN2A/P16-INK4A antibody 81373-10-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...