Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

P2RX4 Polyclonal antibody

P2RX4 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, ELISA

ATP receptor, P2X purinoceptor 4, P2X4, P2X4R, Purinergic receptor

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for P2RX4 in ?

Tested Applications

Positive WB detected inHeLa cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13534-1-AP targets P2RX4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4445

Product name: Recombinant human P2RX4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 57-341 aa of BC033826

Sequence: TDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGS

Predict reactive species
Full Name purinergic receptor P2X, ligand-gated ion channel, 4
Calculated Molecular Weight 388 aa, 43 kDa
Observed Molecular Weight 45-60 kDa
GenBank Accession NumberBC033826
Gene Symbol P2RX4
Gene ID (NCBI) 5025
RRIDAB_2236528
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99571
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2RX4 (P2X purinoceptor 4) is a receptor for ATP acting as a ligand gated ion channel. The calculated molecular weight of P2RX4 is 43 kDa, larger apparent molecular weights of 50-80 kDa have been reported, possibly due to post-translational glycosylation (PMID: 24040145, 15262999; 29382907; 12566439). The antibody can detect the band around 45 kDa.

Protocols

Product Specific Protocols
IHC protocol for P2RX4 antibody 13534-1-APDownload protocol
WB protocol for P2RX4 antibody 13534-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-P2X4R antibody (Cat# 13534-1-AP) has 19 total citations published in journals including Autophagy, Science Advances, Journal of Neuroinflammation, CNS Neuroscience & Therapeutics, International Immunopharmacology, Experimental Neurology, Biomedicines, Purinergic Signaling, and Molecular Pain. Research fields span neuropathic pain, neuroinflammation, microglial activation, ischemic stroke, migraine, depression, hepatocellular carcinoma, colorectal cancer, breast cancer, peripheral nerve injury, and cough hypersensitivity.

SpeciesApplicationTitle
human

Autophagy

Periplocin suppresses the growth of colorectal cancer cells by triggering LGALS3 (galectin 3)-mediated lysophagy

Authors - Kui Wang
mouseWB

Sci Adv

α-Ketoglutaric acid ameliorates hyperglycemia in diabetes by inhibiting hepatic gluconeogenesis via serpina1e signaling.

Authors - Yexian Yuan
  • KD Validated
mouseWB,IHC

J Neuroinflammation

A BRD4/p300/SP1 epigenetic cascade drives microglial P2X4R transcription and promotes neuropathic pain.

Authors - Daojuan Wang
mouseIHC

J Headache Pain

Microglia P2X4R-BDNF signalling contributes to central sensitization in a recurrent nitroglycerin-induced chronic migraine model.

Authors - Ting Long
mouseWB,IF

Phytother Res

Analgesic effect of nobiletin against neuropathic pain induced by the chronic constriction injury of the sciatic nerve in mice

Authors - Chunhao Zhu
humanIF

CNS Neurosci Ther

Activation of P2X4 receptor exacerbates acute brain injury after intracerebral hemorrhage.

Authors - Si-Ting Wu
Loading...
||
New chat

Able™

正在加载,请稍候...