Use Able AI chat for product recommendations

PDGFR beta/CD140b Recombinant monoclonal antibody

PDGFR beta/CD140b Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84388-5-RR
Clone No.241754A6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, ELISA

241754A6, Beta platelet-derived growth factor receptor, Beta-type platelet-derived growth factor receptor, CD140 antigen-like family member B, CD140b

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, C2C12 cells
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84388-5-RR targets PDGFR beta/CD140b in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1533

Product name: Recombinant Mouse PDGFR beta protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 32-531 aa of NM_008809.2

Sequence: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKV

Predict reactive species
Full Name platelet derived growth factor receptor, beta polypeptide
Calculated Molecular Weight123kDa
Observed Molecular Weight180 kDa
GenBank Accession NumberNM_008809.2
Gene Symbol PDGFR beta
Gene ID (NCBI) 18596
RRIDAB_3671924
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP05622-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet-derived growth Factor Receptor Beta (PDGFRβ) is a member of the receptor tyrosine kinase family of proteins, which plays a crucial role in various physiological and pathological conditions.

Protocols

Product Specific Protocols
IF protocol for PDGFR beta/CD140b antibody 84388-5-RRDownload protocol
WB protocol for PDGFR beta/CD140b antibody 84388-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    1.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ana (Verified Customer) (03-14-2026)

We tested this antibody as an alternative to αSMA for the identification of pericytes by immunohistochemistry in murine tumor tissues with strong angiogenesis. To optimize staining, we performed several conditions. Initial testing was done in colon tissue (32 min antigen retrieval, 1:100 dilution, 40 min incubation). We then tested placenta and testis with 40 min antigen retrieval and 1:100 dilution. Additional experiments were performed using 40 min antigen retrieval with a higher concentration (1:50) in kidney, placenta, and colon. Finally, we tested 40 min antigen retrieval with 1:50 dilution and overnight incubation in kidney, placenta, and colon. Despite testing multiple antigen retrieval conditions, antibody concentrations, and incubation times, we were unable to detect specific staining in any of the tested tissues. Under our experimental conditions, the antibody did not produce detectable labeling by immunohistochemistry, at least in our hands.

  • Applications: Immunohistochemistry
  • Cell Tissue Type: Mouse tissues (kidney, placenta, colon)
Loading...
||
New chat

Able

正在加载,请稍候...