Mouse PDGFR beta/CD140b Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84388-5-RR (same clone as 84388-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84388-5-RR (PDGF R beta antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84388-5-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 84388-5-RR (same clone as 84388-5-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed NIH/3T3 cells using PDGFR beta/CD140b antibody (84388-5-RR, Clone: 241754A6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84388-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84388-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84388-5-RR against Mouse PDGF R beta were performed. The affinity constant is below 1 pM.

PDGFR beta/CD140b Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84388-5-PBS

Clone No.241754A6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

241754A6, Beta platelet-derived growth factor receptor, Beta-type platelet-derived growth factor receptor, CD140 antigen-like family member B, CD140b

---

Product Information

84388-5-PBS targets PDGFR beta/CD140b in WB, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1533

  Product name: Recombinant Mouse PDGFR beta protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 32-531 aa of NM_008809.2

  Sequence: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKV

• Full Name: platelet derived growth factor receptor, beta polypeptide
• Calculated Molecular Weight: 123kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: NM_008809.2
• Gene Symbol: PDGFR beta
• Gene ID (NCBI): 18596
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P05622-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Platelet-derived growth Factor Receptor Beta (PDGFRβ) is a member of the receptor tyrosine kinase family of proteins, which plays a crucial role in various physiological and pathological conditions.