PGM2L1 Recombinant monoclonal antibody

PGM2L1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86209-1-RR
Clone No.250849G1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

BM32A, EC:2.7.1.106, Glucose 1,6-bisphosphate synthase, Phosphoglucomutase-2-like 1, PMMLP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, U-251 cells, A549 cells, mouse brain tissue, rat brain tissue, mouse cerebellum tissue, rat cerebellum tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86209-1-RR targets PGM2L1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5019

Product name: Recombinant human PGM2L1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 269-622 aa of BC059360

Sequence: GHDYVQLAFKVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWKVFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIIDLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDITTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKKLIDALIENFLQPSKNGLIWRSV

Predict reactive species
Full Name phosphoglucomutase 2-like 1
Calculated Molecular Weight 70 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC059360
Gene Symbol PGM2L1
Gene ID (NCBI) 283209
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6PCE3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PGM2L1 (Phosphoglucomutase 2 Like 1) is an enzyme-like protein involved in carbohydrate metabolism. PGM2L1 catalyzes the formation of G16BP by using the glycolytic intermediate 1,3-bisphosphoglycerate as a phosphate donor and glucose-1-phosphate or glucose-6-phosphate as a phosphate acceptor. PGM2L1 plays a crucial role in glycogen metabolism, glycolysis, and gluconeogenesis as a key enzyme, and increasing evidence links its function to cancer metabolism and progression. While PGM2 has a wide tissue distribution, PGM2L1 is highly expressed in the brain, accounting for the elevated concentrations of glucose-1,6-bisphosphate found there (PMID: 33979636, PMID: 40027181).

Protocols

Product Specific Protocols
WB protocol for PGM2L1 antibody 86209-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...