Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PRDM15 Polyclonal antibody

PRDM15 Polyclonal Antibody for WB, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ChIP, ELISA

C21orf83, PFM15, PR domain containing 15, PRDM15, Zinc finger protein 298, ZNF298

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PRDM15 in ?

Tested Applications

Positive WB detected inMCF-7 cells, Jurkat cells
Positive IP detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25590-1-AP targets PRDM15 in WB, IHC, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22296

Product name: Recombinant human PRDM15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 791-1141 aa of BC067102

Sequence: KHCKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQPELTLEQEDLAEGKHGKAAKRSHKRKQKPEEEAGAPVPEDATFSEYSEKETEFTGSVGDETNSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTAAATQFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLVNSITPLGSQLSDQHPLTWRAVPQTDVLPPPQPQAPPQQAAQPQVQAEQQQQQMYSY

Predict reactive species
Full Name PR domain containing 15
Calculated Molecular Weight 1507 aa, 169 kDa
Observed Molecular Weight 169 kDa
GenBank Accession NumberBC067102
Gene Symbol PRDM15
Gene ID (NCBI) 63977
RRIDAB_2880145
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP57071
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PR-domain containing proteins (PRDMs) have a common involvement in the modulation of gene activities. A PR-domain family member usually produces two products, called PR-plus and PR-minus, which differ by the presence or absence of the PR domain, respectively. The PR-plus product is underexpressed or disrupted in cancer cells, whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, which is a result of either genetic or epigenetic events, appears to be a determining factor of malignancy. PRDM15 (PR domain-containing protein 15), also known as PFM15 or ZNF298, is a 1507 amino acid protein belonging to the PRDM family. Localizing to the nucleus, PRDM15 contains sixteen C2H2-type zinc fingers and one SET domain. It is believed to participate in transcriptional regulation and may be involved in cell differentiation and tumorigenesis. PRDM15 exists several isoform and molecular weight of respective isoform is 169 kDa, 135kda, 62kDa.

Protocols

Product Specific Protocols
IP protocol for PRDM15 antibody 25590-1-APDownload protocol
WB protocol for PRDM15 antibody 25590-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PRDM15 Polyclonal antibody (Cat# 25590-1-AP) has 3 total citations published in Nature Cell Biology, Journal of Experimental & Clinical Cancer Research, and Biochimica et Biophysica Acta – Molecular Basis of Disease. The cited research spans coronary atherosclerosis and endothelial progenitor remodeling, cholangiocarcinoma growth via RNA methylation and FGFR4 signaling, and colorectal carcinogenesis involving p53 destabilization. Applications used include WB, IHC, and ChIP in human samples.

SpeciesApplicationTitle

Nat Cell Biol

Single-cell transcriptomics uncovers endothelial progenitor-like remodelling driving human coronary atherosclerosis progression.

Authors - Fang Yao
humanWB

J Exp Clin Cancer Res

The RNA methyltransferase METTL16 enhances cholangiocarcinoma growth through PRDM15-mediated FGFR4 expression

Authors - Nianli Liu
  • KD Validated
humanWB,IHC,ChIP

Biochim Biophys Acta Mol Basis Dis

PRDM15 promotes colorectal carcinogenesis by transcriptionally repressing USP10 to destabilize p53.

Authors - Chongyang Wu
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...