Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PKC Alpha Polyclonal antibody

PKC Alpha Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Cat No. 21991-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

PRKCA, AAG6, EC:2.7.11.13, PKC A, PKCA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, human peripheral blood platelets, rat kidney tissue
Positive IP detected inNIH/3T3 cells
Positive IHC detected inhuman thyroid cancer tissue, mouse brain tissue, mouse eye tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat eye tissue
Positive IF/ICC detected inHeLa cells, NIH/3T3 cells, HepG2 cells
Positive FC (Intra) detected inHeLa cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21991-1-AP targets PKC Alpha in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17275

Product name: Recombinant human PRKCA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-216 aa of BC109274

Sequence: MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIR

Predict reactive species
Full Name protein kinase C, alpha
Calculated Molecular Weight 77 kDa
Observed Molecular Weight 77 kDa
GenBank Accession NumberAK055431
Gene Symbol PKC Alpha
Gene ID (NCBI) 5578
RRIDAB_2878965
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17252
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. PRKCA is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.

Protocols

Product Specific Protocols
FC protocol for PKC Alpha antibody 21991-1-APDownload protocol
IF protocol for PKC Alpha antibody 21991-1-APDownload protocol
IHC protocol for PKC Alpha antibody 21991-1-APDownload protocol
IP protocol for PKC Alpha antibody 21991-1-APDownload protocol
WB protocol for PKC Alpha antibody 21991-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Adv Sci (Weinh)

LncRNA Foxo6os as a Novel " Scaffold" Mediates MYBPC3 in Combating Pathological Cardiac Hypertrophy and Heart Failure

Authors - Jie Sheng
human

Cancer Lett

RSK2-mediated phosphorylation and degradation of UBE2O inhibits hepatocellular carcinoma growth and resistance to radiotherapy

Authors - Yumei Huang
humanWB

Theranostics

MED13L integrates Mediator-regulated epigenetic control into lung cancer radiosensitivity.

Authors - Nasha Zhang
humanIF

Cell Death Dis

ATF4/CEMIP/PKCα promotes anoikis resistance by enhancing protective autophagy in prostate cancer cells.

Authors - Ying Yu
humanWB

Cell Death Differ

β-Trcp ubiquitin ligase and RSK2 kinase-mediated degradation of FOXN2 promotes tumorigenesis and radioresistance in lung cancer.

Authors - Jia Ma
humanWB

Oncogene

β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma.

Authors - Yanwei Lu

Reviews

    4.8 out of 5
Add a review

6 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Mounika (Verified Customer) (09-02-2026)

works very well, helped our project.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000

Gaurav (Verified Customer) (12-05-2025)

Works with Primary Cells

  • Applications: Western Blot, Flow Cytometry, Cell culture
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: Primary Aortic SMCs

Alessandro (Verified Customer) (11-07-2022)

no unspecific staining, great outcome

  • Applications: Immunofluorescence

Chiara (Verified Customer) (10-04-2021)

Works very well in Immunoblot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: mesenchymal Stem cell

Samantha (Verified Customer) (02-24-2020)

Bovine vascular smooth muscle cells were transfected with either control siRNA or PKCalpha siRNA for up to 7 days, with transfections repeated every 48-72 hours. Blocking agent: 5% (w/v) milk in TBST for 1hrPrimary antibody diluted in 5% (w/v) milk in TBST; incubated overnight at 4 degrees.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:750
  • Cell Tissue Type: Bovine vascular smooth muscle cells
PKC Alpha Antibody Western Blot, validation (1:750 dilution) in Bovine vascular smooth muscle cells (Cat no:21991-1-AP)

Ryan (Verified Customer) (01-10-2018)

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish Retina
PKC Alpha Antibody Immunohistochemistry, validation (1:100 dilution) in Zebrafish Retina (Cat no:21991-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...