• Featured Product
  • KD/KO Validated

PRMT5 Recombinant monoclonal antibody

PRMT5 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 82750-3-RR
Clone No.250553F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

72 kDa ICln-binding protein, EC:2.1.1.320, Histone-arginine N-methyltransferase PRMT5, Jak-binding protein 1, Protein arginine N methyltransferase 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, mouse brain tissue, NIH/3T3 cells, Raji cells, rat brain tissue
Positive IHC detected inhuman colon cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82750-3-RR targets PRMT5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9736

Product name: Recombinant human PRMT5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 283-637 aa of BC025979

Sequence: YLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

Predict reactive species
Full Name protein arginine methyltransferase 5
Calculated Molecular Weight 637 aa, 73 kDa
Observed Molecular Weight67-70 kDa
GenBank Accession NumberBC025979
Gene Symbol PRMT5
Gene ID (NCBI) 10419
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14744
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRMT5 is a Type II enzyme that catalyzes arginine monomethylation and symmetric dimethylation (Rme1 and Rme2s). The many targets of PRMT5 include ribosomal proteins, the histone chaperone nucleoplasmin, p53, and histones. PRMT5 is frequently observed in a complex with the cofactor, methylosome protein 50 (MEP50), which is required for PRMT5 activity. PRMT5 is upregulated in several human malignancies, including lymphomas, lung cancer, breast cancer and colorectal cancer.

Protocols

Product Specific Protocols
IF protocol for PRMT5 antibody 82750-3-RRDownload protocol
IHC protocol for PRMT5 antibody 82750-3-RRDownload protocol
WB protocol for PRMT5 antibody 82750-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...