Use Able AI chat for product recommendations

PTH2R Polyclonal antibody

PTH2R Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

parathyroid hormone 2 receptor, PTH2 receptor, PTHR2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PTH2R in ?

Tested Applications

Positive WB detected inL02 cells, BxPC-3 cells, human testis tissue, mouse liver tissue, mouse pancreas tissue, mouse testis tissue
Positive IHC detected inhuman pancreas cancer tissue, human renal cell carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inBxPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14166-1-AP targets PTH2R in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5364

Product name: Recombinant human PTH2R protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 419-550 aa of BC036811

Sequence: EVQAEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISGKAAKIASRQPDSHITLPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETEDVL

Predict reactive species
Full Name parathyroid hormone 2 receptor
Calculated Molecular Weight 550 aa, 62 kDa
Observed Molecular Weight 62-66 kDa
GenBank Accession NumberBC036811
Gene Symbol PTH2R
Gene ID (NCBI) 5746
RRIDAB_2253212
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49190
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Parathyroid hormone 2 receptor (PTH2R, also known as PTHR2) is a member of the secretin receptor family of G protein-coupled receptors. PTH2R selectively recognizes parathyroid hormone and is particularly abundant in the brain and pancreas (PMID: 7797535). Tuberoinfundibular peptide of 39 residues (TIP39) is the endogenous ligand of the PTH2R in the brain, and they form a neuromodulator system (PMID: 19857544). PTH2R is involved in the regulation of calcium transport, nociception mediation, and wound healing (PMID: 34353904).

Protocols

Product Specific Protocols
FC protocol for PTH2R antibody 14166-1-APDownload protocol
IHC protocol for PTH2R antibody 14166-1-APDownload protocol
WB protocol for PTH2R antibody 14166-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PTH2R Polyclonal antibody (Cat# 14166-1-AP) has 3 citations published in Advanced Science, Arteriosclerosis, Thrombosis and Vascular Biology, and International Journal of Hematology. The cited research spans neuroscience (depressive-like behaviors and glutamatergic neurotransmission), cardiovascular biology (pulmonary hypertension), and hematology/oncology (autophagy in myeloid neoplasms). All citations used the antibody for Western blot applications across human, mouse, and rat species.

SpeciesApplicationTitle
mouseWB

Adv Sci (Weinh)

Adenylyl Cyclase 8 in Dorsal CA1 Neurons Prevents Depressive-Like Behaviors by Maintaining Neuronal Excitability and Glutamatergic Neurotransmission Through TIP39-PTH2R Signaling.

Authors - Zi-Jie Liu
ratWB

Arterioscler Thromb Vasc Biol

Binding of Hypoxia-Induced Mitogenic Factor/RELM-β to Bone Morphogenetic Protein Receptor 2 Complex Promotes Pulmonary Hypertension.

Authors - Ting Zhang
humanWB

Int J Hematol

Neuropeptide TIP39 induces autophagy in PTH2 receptor-positive myeloid neoplasms

Authors - Kento Ono
Loading...
||
New chat

Able™

正在加载,请稍候...