RBPJ Recombinant monoclonal antibody

RBPJ Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85676-3-RR
Clone No.243044G4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

CBF 1, CBF1, CBF-1, csl, IGKJRB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cell, HEK-293 cells, Jurkat cells, MCF-7 cells, C6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85676-3-RR targets RBPJ in WB, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32552

Product name: Recombinant human RBPJ protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 380-486 aa of BC064976

Sequence: MYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS

Predict reactive species
Full Name recombination signal binding protein for immunoglobulin kappa J region
Calculated Molecular Weight 56 kDa
Observed Molecular Weight~60 kDa
GenBank Accession NumberBC064976
Gene Symbol RBPJ
Gene ID (NCBI) 3516
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06330
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBPJ, also named as IGKJRB, IGKJRB1, RBPJK, RBPSUH, NY-REN-30, CBF-1 and CSL, belongs to the Su(H) family. It is a transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. RBPJ acts as a transcriptional repressor when it is not associated with Notch proteins. It is specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. RBPJ binds to the Runx3 promoter in the atrioventricular canal in vivo, and inhibition of Notch reduces RUNX3 expression in the cardiac cushion of embryonic hearts.

Protocols

Product Specific Protocols
WB protocol for RBPJ antibody 85676-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...