Tested Applications
| Positive WB detected in | A549 cells, PC-3 cells, HT-29 cells |
| Positive IP detected in | HT-29 cells |
| Positive IHC detected in | human renal cell carcinoma tissue, mouse kidney tissue, mouse colon tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27457-1-AP targets RRAS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26538 Product name: Recombinant human RRAS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 145-218 aa of BC016318 Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL Predict reactive species |
| Full Name | related RAS viral (r-ras) oncogene homolog |
| Calculated Molecular Weight | 218 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC016318 |
| Gene Symbol | RRAS |
| Gene ID (NCBI) | 6237 |
| RRID | AB_2880876 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10301 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RRAS antibody 27457-1-AP | Download protocol |
| IP protocol for RRAS antibody 27457-1-AP | Download protocol |
| WB protocol for RRAS antibody 27457-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-RRAS antibody (Cat# 27457-1-AP) has 6 total citations across journals including Nature Communications, Hepatology, Biomaterials, Cancer Letters, Frontiers in Bioscience, and Translational Cancer Research. Research fields span neuroblastoma, hepatocellular carcinoma metastasis, glioblastoma therapy, oral squamous cell carcinoma, ferroptosis in glioblastoma, and nasopharyngeal carcinoma. Applications include WB and IHC in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Nat Commun Targeting NRAS via miR-1304-5p or farnesyltransferase inhibition confers sensitivity to ALK inhibitors in ALK-mutant neuroblastoma | ||
Hepatology Metabolism-induced tumor activator 1 (MITA1), an Energy Stress-Inducible Long Noncoding RNA, Promotes Hepatocellular Carcinoma Metastasis | ||
Biomaterials Polymeric nanoparticle mediated inhibition of miR-21 with enhanced miR-124 expression for combinatorial glioblastoma therapy. | ||
Cancer Lett Integrated multi-omics analyses of oral squamous cell carcinoma reveal precision patient stratification and personalized treatment strategies | ||
Front Biosci (Landmark Ed) Immune Characteristics of eQTL and Gene Risk Model and the Inhibitory Effect of DCTD and RRAS on Ferroptosis in Glioblastoma
| ||
Transl Cancer Res Identification of RRAS gene related to nasopharyngeal carcinoma based on pathway and network-based analyses. |
