RTN2 Recombinant monoclonal antibody

RTN2 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 86162-1-RR
Clone No.250823C1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Neuroendocrine-specific protein-like 1, Neuroendocrine-specific protein-like I, NSPL1, NSPLI, NSP-like protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, HeLa cells, K-562 cells, rat heart tissue, mouse skeletal muscle tissue, rat skeletal muscle
Positive IHC detected inhuman ovary cancer tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86162-1-RR targets RTN2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1655

Product name: Recombinant human RTN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 344-545 aa of BC014244

Sequence: KVADLLYWKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGSKAKAE

Predict reactive species
Full Name reticulon 2
Calculated Molecular Weight 59 kDa, 51 kDa, 22 kDa
Observed Molecular Weight 20-23 kDa
GenBank Accession NumberBC014244
Gene Symbol RTN2
Gene ID (NCBI) 6253
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75298
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. Human RTN2 gene produces three isoforms termed RTN2-A, RTN2-B, and RTN2-C. Isoform RTN2-C has a calculated molecular weight of 22 kDa and is highly expressed in skeletal muscle.

Loading...
||
New chat Able
正在加载,请稍候...