RTN2 Recombinant monoclonal antibody, PBS Only (Capture)

RTN2 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 86162-1-PBS
Clone No.250823C1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Neuroendocrine-specific protein-like 1, Neuroendocrine-specific protein-like I, NSPL1, NSPLI, NSP-like protein 1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86162-1-PBS targets RTN2 as part of a matched antibody pair:

MP02385-1: 86162-1-PBS capture and 86162-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1655

Product name: Recombinant human RTN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 344-545 aa of BC014244

Sequence: KVADLLYWKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGSKAKAE

Predict reactive species
Full Name reticulon 2
Calculated Molecular Weight 59 kDa, 51 kDa, 22 kDa
Observed Molecular Weight 20-23 kDa
GenBank Accession NumberBC014244
Gene Symbol RTN2
Gene ID (NCBI) 6253
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75298
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. Human RTN2 gene produces three isoforms termed RTN2-A, RTN2-B, and RTN2-C. Isoform RTN2-C has a calculated molecular weight of 22 kDa and is highly expressed in skeletal muscle.

Loading...
||
New chat

Able

正在加载,请稍候...