RTN2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86162-1-RR (same clone as 86162-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86162-1-RR (RTN2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86162-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86162-1-RR (same clone as 86162-1-PBS)

  Various cell lysates were subjected to SDS PAGE followed by western blot with 86162-1-RR (RTN2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86162-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 86162-1-RR (same clone as 86162-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 86162-1-RR (RTN2 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86162-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 86162-1-RR (same clone as 86162-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 86162-1-RR (RTN2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86162-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02385-1

  The mean RTN2 concentration was determined to be 4623.0 ng/mL in Mouse skeletal muscle tissue extract based on a 4.1 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02385-1

  Cytometric bead array standard curve of MP02385-1, RTN2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86162-1-PBS. Detection antibody: 86162-2-PBS. Standard: Ag1655. Range: 0.469-60 ng/mL.

• 

  Affinity and Kinetic Characterization of 86162-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86162-1-RR against Human RTN2 were performed. The affinity constant is 0.358 nM.

RTN2 Uni-rAb^® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 86162-1-PBS

Clone No.250823C1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

Neuroendocrine-specific protein-like 1, Neuroendocrine-specific protein-like I, NSPL1, NSPLI, NSP-like protein 1

---

Product Information

86162-1-PBS targets RTN2 as part of a matched antibody pair:

MP02385-1: 86162-1-PBS capture and 86162-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1655

  Product name: Recombinant human RTN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 344-545 aa of BC014244

  Sequence: KVADLLYWKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGSKAKAE

• Full Name: reticulon 2
• Calculated Molecular Weight: 59 kDa, 51 kDa, 22 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC014244
• Gene Symbol: RTN2
• Gene ID (NCBI): 6253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75298
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. Human RTN2 gene produces three isoforms termed RTN2-A, RTN2-B, and RTN2-C. Isoform RTN2-C has a calculated molecular weight of 22 kDa and is highly expressed in skeletal muscle.