• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Use Able AI chat for product recommendations
Filter:
  • Western Blot (WB) analysis of various lysates using RXRB Recombinant antibody (84656-4-RR)

    WB analysis using 84656-4-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 84656-4-RR (RXRB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of human colon cancer tissue using RXRB Recombinant antibody (84656-4-RR)

    IHC staining of human colon cancer using 84656-4-RR

    Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84656-4-RR (RXRB antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human colon cancer tissue using RXRB Recombinant antibody (84656-4-RR)

    IHC staining of human colon cancer using 84656-4-RR

    Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84656-4-RR (RXRB antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using RXRB Recombinant antibody (84656-4-RR)

    IF Staining of MCF-7 using 84656-4-RR

    Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using RXRB antibody (84656-4-RR, Clone: 242178D4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  • Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using RXRB Recombinant antibody (84656-4-RR)

    IF Staining of MCF-7 using 84656-4-RR

    Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using RXRB antibody (84656-4-RR, Clone: 242178D4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  • Flow cytometry (FC) experiment of HeLa cells using RXRB Recombinant antibody (84656-4-RR)

    FC experiment of HeLa using 84656-4-RR

    1x10^6 HeLa cells were intracellularly stained with 0.25 ug RXRB Recombinant antibody (84656-4-RR, Clone:242178D4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  • Affinity and Kinetic Characterization of 84656-4-RR

    Affinity and Kinetic Characterization of 84656-4-RR

    Biolayer interferometry (BLl) kinetic assays of 84656-4-RR against Human RXRB were performed. The affinity constant is 1.24 nM.

RXRB Recombinant monoclonal antibody

RXRB Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 84656-4-RR
Clone No.242178D4

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

242178D4, DAUDI6, H 2RIIBP, NR2B2, RCoR 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inSK-BR-3 cells, K-562 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84656-4-RR targets RXRB in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0263

Product name: Recombinant human RXRB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 70-238 aa of BC001167

Sequence: RDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLT

Predict reactive species
Full Name retinoid X receptor, beta
Calculated Molecular Weight 57 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC001167
Gene Symbol RXRB
Gene ID (NCBI) 6257
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP28702
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Retinoid X Receptor beta (RXRB) is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid. RXRB heterodimerizes with other nuclear hormone receptors, such as RAR, the thyroid hormone receptor, and the vitamin D3 receptor, to enhance binding to their cognate response elements. (PMID: 8257090)

Protocols

Product Specific Protocols
FC protocol for RXRB antibody 84656-4-RRDownload protocol
IF protocol for RXRB antibody 84656-4-RRDownload protocol
IHC protocol for RXRB antibody 84656-4-RRDownload protocol
WB protocol for RXRB antibody 84656-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...