• Featured Product
  • KD/KO Validated

S100A14 Recombinant monoclonal antibody

S100A14 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83559-5-RR
Clone No.240528B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

240528B6, Protein S100 A14, Protein S100-A14, S100 calcium-binding protein A14, S100A15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse stomach tissue, MCF-7 cells, rat stomach tissues, human saliva samples
Positive IHC detected inhuman ovary cancer tissue, human intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83559-5-RR targets S100A14 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0757

Product name: Recombinant human S100A14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-104 aa of BC005019

Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Predict reactive species
Full Name S100 calcium binding protein A14
Calculated Molecular Weight 12 kDa
Observed Molecular Weight12 kDa
GenBank Accession NumberBC005019
Gene Symbol S100A14
Gene ID (NCBI) 57402
RRIDAB_3671175
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9HCY8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The S100 family is a multifunctional group of EF-hand type calciumbinding proteins. S100A14 protein (previously known as BCMP84, S100A15) is a recently identified member of the S100 family. It is differentially expressed in a number of different human malignancies like ovary, breast, uterus, kidney, rectum and colon cancers, and esophageal and oral squamous cell carcinomas (OSCCs).7

Protocols

Product Specific Protocols
FC protocol for S100A14 antibody 83559-5-RRDownload protocol
IHC protocol for S100A14 antibody 83559-5-RRDownload protocol
WB protocol for S100A14 antibody 83559-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...