SAMD4A Recombinant monoclonal antibody

SAMD4A Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86530-1-RR
Clone No.251369F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

hSmaug1, KIAA1053, Protein Smaug homolog 1, SAM domain-containing protein 4A, SAMD4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, rat testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86530-1-RR targets SAMD4A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11273

Product name: Recombinant human SAMD4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-383 aa of BC021726

Sequence: LLNPYQAAAWDSICPIHWRLTDIIEGGSLRIPLQELHQMILTPIKAYSSPSTTPEARRREPQAPRQPSLMGPESQSPDCKDGAAATGATATPSAGASGGLQPHQLSSCDGELAVAPLPEGDLPGQFTRVMGKVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTETQKKRLLSWKQQVQKLFRSFPRKTLLDISGYRQQRNRGFGQSNSLPTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQNLWFANPGGSNSMPSRTHSSVQRTRSLPVHTSPQNMLMFQQPGSQVHSGLCLTDLRGWLSLSGAPSMPALTVPKSSQGEFQLPVTEPDINNRLESLCLSMTEHALGDGVDRTSTI

Predict reactive species
Full Name sterile alpha motif domain containing 4A
Calculated Molecular Weight 529 aa, 59 kDa
Observed Molecular Weight 70-71 kDa
GenBank Accession NumberBC021726
Gene Symbol SAMD4A
Gene ID (NCBI) 23034
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UPU9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SAMD4A is also named as KIAA1053, SAMD4, SMAUG1, hSmaug1 and belongs to the SMAUG family. SAMD4A acts as a translational repressor of SRE-containing messengers. (PMID:16221671). In particular, as orthologous alternative splicing isoforms, mouse Samd4a E-form and human SAMD4A C-form containing the SAM domain were specific to testes. Samd4a/SAMD4A plays an essential role in normal spermatogenesis, and SAMD4A, as a spermatid specific marker, can be used for subcategorizing nonobstructive azoospermia patients (PMID:36274854). In mammalian cells, human SAMD4A can form a kind of mRNA‐silencing foci in the cytoplasm, acting differently from processing body and stress granules. Recently, it was reported that human SAMD4A can protect the host from viral infection by degrading viral RNA (PMID: 32341522). Indition, 14-3-3s negatively regulate the localization of the RNA-binding protein SAMD4A to cytoplasmic granules and inhibit its activity as a translational repressor (PMID: 36931259).

Protocols

Product Specific Protocols
WB protocol for SAMD4A antibody 86530-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...