SCAMP5 Recombinant monoclonal antibody

SCAMP5 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85669-2-RR
Clone No.243122F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

hSCAMP5, Secretory carrier-associated membrane protein 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, 37°C incubated mouse brain tissue, rat brain tissue, 37°C incubated rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85669-2-RR targets SCAMP5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag31837

Product name: Recombinant human SCAMP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 170-235 aa of BC024700

Sequence: SMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM

Predict reactive species
Full Name secretory carrier membrane protein 5
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC024700
Gene Symbol SCAMP5
Gene ID (NCBI) 192683
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TAC9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Secretory carrier-associated membrane protein 5 (SCAMP5) belongs to the to the SCAMP family. Secretory carrier membrane proteins (SCAMPs) constitute a group of membrane transport proteins in plants, insects and mammals. The mammalian genome contains five types of SCAMP genes, namely, SCAMP1-SCAMP5. (PMID:36217917, PMID:19234194). SCAMPs participate in the vesicle cycling fusion of vesicles and cell membranes and play roles in regulating exocytosis and endocytosis, activating synaptic function and transmitting nerve signals. Among these proteins, SCAMP5 is highly expressed in the brain and has direct or indirect effects on the function of the central nervous system (PMID:36217917). SCAMP5 regulates membrane transport, controls the exocytosis of synaptic vesicles and is related to secretion carrier and membrane function. In addition, SCAMP5 plays a major role in the normal maintenance of the physiological functions of nerve cells (PMID:36217917, PMID:33663553). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis.

Protocols

Product Specific Protocols
WB protocol for SCAMP5 antibody 85669-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...