Use Able AI chat for product recommendations

SCAMP5 Recombinant monoclonal antibody, PBS Only (Capture)

SCAMP5 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85669-2-PBS
Clone No.243122F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

hSCAMP5, Secretory carrier-associated membrane protein 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85669-2-PBS targets SCAMP5 as part of a matched antibody pair:

MP02041-2: 85669-2-PBS capture and 85669-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag31837

Product name: Recombinant human SCAMP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 170-235 aa of BC024700

Sequence: SMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM

Predict reactive species
Full Name secretory carrier membrane protein 5
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC024700
Gene Symbol SCAMP5
Gene ID (NCBI) 192683
RRIDAB_3744278
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TAC9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Secretory carrier-associated membrane protein 5 (SCAMP5) belongs to the to the SCAMP family. Secretory carrier membrane proteins (SCAMPs) constitute a group of membrane transport proteins in plants, insects and mammals. The mammalian genome contains five types of SCAMP genes, namely, SCAMP1-SCAMP5. (PMID:36217917, PMID:19234194). SCAMPs participate in the vesicle cycling fusion of vesicles and cell membranes and play roles in regulating exocytosis and endocytosis, activating synaptic function and transmitting nerve signals. Among these proteins, SCAMP5 is highly expressed in the brain and has direct or indirect effects on the function of the central nervous system (PMID:36217917). SCAMP5 regulates membrane transport, controls the exocytosis of synaptic vesicles and is related to secretion carrier and membrane function. In addition, SCAMP5 plays a major role in the normal maintenance of the physiological functions of nerve cells (PMID:36217917, PMID:33663553). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis.

Loading...
||
New chat

Able

正在加载,请稍候...