Mammaglobin A Polyclonal antibody

Mammaglobin A Polyclonal Antibody for WB, IHC, ELISA
Cat No. 23501-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

hMAM, Mammaglobin 1, Mammaglobin A, MGB1, SCGB2A2, UGB2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

23501-1-AP targets Mammaglobin A in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20122

Product name: Recombinant human SCGB2A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 50-120 aa of BC067220

Sequence: IDDNATTNAIDELKECFLNQTDETLSNVEVFMVISFSSYKLFKSPDQGQVGSSFLTDNAKATSEQAFSYIG

Predict reactive species
Full Name secretoglobin, family 2A, member 2
Calculated Molecular Weight 120 aa, 13 kDa
Observed Molecular Weight 6-10 kDa
GenBank Accession NumberBC067220
Gene Symbol Mammaglobin A
Gene ID (NCBI) 4250
RRIDAB_2879289
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13296
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa. This polyclonal antibody is raised against the C-terminal 71 amino acids of the protein encoded by a cDNA (MGC:71974; BC067220).

Protocols

Product Specific Protocols
IHC protocol for Mammaglobin A antibody 23501-1-APDownload protocol
WB protocol for Mammaglobin A antibody 23501-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Mol Med Rep

Immunolocalization of MMP9 and MMP2 in osteolytic metastasis originating from MDA-MB-231 human breast cancer cells.

Authors - Bo Liu
Loading...
||
New chat Able
正在加载,请稍候...