Use Able AI chat for product recommendations

14-3-3 Sigma Monoclonal antibody

14-3-3 Sigma Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66251-1-Ig
Clone No. 3F10D9
Publications (7)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

14-3-3 protein sigma, 14-3-3sigma, 3F10D9, HME1, SFN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for 14-3-3 Sigma in ?

Tested Applications

Positive WB detected inA-253 cells, A431 cells, HeLa cells, MCF-7 cells, HT-1376 cells, HaCaT cells, SCaBER cells, MCF-10A cells, MDA-MB-468 cells
Positive IHC detected inhuman skin tissue, human breast cancer tissue, human breast hyperplasia tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66251-1-Ig targets 14-3-3 Sigma in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12644

Product name: Recombinant human SFN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-248 aa of BC002995

Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Predict reactive species
Full Name stratifin
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28-30 kDa
GenBank Accession NumberBC002995
Gene Symbol 14-3-3 Sigma
Gene ID (NCBI) 2810
RRIDAB_2881639
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP31947
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

14-3-3 Sigma is a member 14-3-3 family of highly conserved proteins participating in diverse cellular processes including cell cycle progression. It is exclusively present in various epithelial cells, and alternatively named as human epithelial marker (HEM), or stratifin. Alteration of its expression has been linked to cancer.

Protocols

Product Specific Protocols
IF protocol for 14-3-3 Sigma antibody 66251-1-IgDownload protocol
IHC protocol for 14-3-3 Sigma antibody 66251-1-IgDownload protocol
WB protocol for 14-3-3 Sigma antibody 66251-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The 14-3-3 Sigma Monoclonal antibody (clone 3F10D9), catalog number 66251-1-Ig, has 7 citations published in journals including Nature Cell Biology, Cancer Cell International, Frontiers in Chemistry, Scientific Reports, Environmental Toxicology, Molecular Biotechnology, and Translational Andrology and Urology. Research fields span pulmonary fibrosis, intrahepatic cholangiocarcinoma, gastric cancer, Fuchs endothelial corneal dystrophy, lung cancer, cervical cancer, and bladder cancer, with applications including IF, IHC, and WB.

SpeciesApplicationTitle
mouse,humanIF

Nat Cell Biol

Persistence of a regeneration-associated, transitional alveolar epithelial cell state in pulmonary fibrosis.

Authors - Yoshihiko Kobayashi

Cancer Cell Int

DNA damage response signature-based prognostic genes for intrahepatic cholangiocarcinoma: a combined analysis of machine learning and biological experiments.

Authors - Kai Lu
humanIHC

Front Chem

Study on the mechanism of TP53 degradation by SFN ubiquitination affecting locally advanced TC progression.

Authors - Ying Peng
humanWB

Sci Rep

TCF4 trinucleotide repeat expansion drives distinct proteomic signatures in Fuchs endothelial corneal dystrophy.

Authors - Taichi Yuasa
humanIHC

Environ Toxicol

Multidimensional progressive single-cell sequencing reveals cell microenvironment composition and cancer heterogeneity in lung cancer

Authors - Hua Chen
humanWB,IHC,IF

Mol Biotechnol

Stratifin (SFN) Regulates Cervical Cancer Cell Proliferation, Apoptosis, and Cytoskeletal Remodeling and Metastasis Progression Through LIMK2/Cofilin Signaling

Authors - Naiyi Du
Loading...
||
New chat

Able™

正在加载,请稍候...