14-3-3 Sigma Monoclonal antibody, PBS Only

• 

  WB analysis using 66251-1-Ig (same clone as 66251-1-PBS)

  Various cell lysates were subjected to SDS PAGE followed by western blot with 66251-1-Ig (14-3-3 sigma antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A-253 using 66251-1-Ig (same clone as 66251-1-PBS)

  A-253 cells were subjected to SDS PAGE followed by western blot with 66251-1-Ig (14-3-3 Sigma antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66251-1-Ig (same clone as 66251-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66251-1-Ig (14-3-3 sigma antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66251-1-Ig (same clone as 66251-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66251-1-Ig (14-3-3 sigma antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 66251-1-Ig (same clone as 66251-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 66251-1-Ig (14-3-3 sigma antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 66251-1-Ig (same clone as 66251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 66251-1-Ig (14-3-3 sigma antibody at dilution of 1:2000 (under 10x lens). This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 66251-1-Ig (same clone as 66251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 66251-1-Ig (14-3-3 sigma antibody at dilution of 1:2000 (under 40x lens). This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66251-1-Ig (same clone as 66251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66251-1-Ig (14-3-3 sigma antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66251-1-Ig (same clone as 66251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66251-1-Ig (14-3-3 sigma antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast hyperplasia using 66251-1-Ig (same clone as 66251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66251-1-Ig (14-3-3 sigma antibody at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast hyperplasia using 66251-1-Ig (same clone as 66251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66251-1-Ig (14-3-3 sigma antibody at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 66251-1-Ig (same clone as 66251-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 14-3-3 Sigma antibody (66251-1-Ig, Clone: 3F10D9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66251-1-PBS in a different storage buffer formulation.

14-3-3 Sigma Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66251-1-PBS

Clone No.3F10D9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

14-3-3 protein sigma, 14-3-3sigma, 3F10D9, HME1, SFN

---

Product Information

66251-1-PBS targets 14-3-3 Sigma in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12644

  Product name: Recombinant human SFN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-248 aa of BC002995

  Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

• Full Name: stratifin
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC002995
• Gene Symbol: 14-3-3 Sigma
• Gene ID (NCBI): 2810
• RRID: AB_2881639
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P31947
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

14-3-3 Sigma is a member 14-3-3 family of highly conserved proteins participating in diverse cellular processes including cell cycle progression. It is exclusively present in various epithelial cells, and alternatively named as human epithelial marker (HEM), or stratifin. Alteration of its expression has been linked to cancer.