Home
Products
Primary Antibodies
Recombinant Antibodies
SLC17A9 Recombinant monoclonal antibody (83505-1-RR)

SLC17A9 Recombinant monoclonal antibody

SLC17A9 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 83505-1-RR

Clone No.240328H7

Publications(2)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

240328H7, C20orf59, FLJ23412, Vesicular nucleotide transporter, VNUT

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCFC (Intra)Affinity

WB analysis using 83505-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 83505-1-RR (SLC17A9 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse pancreas using 83505-1-RR
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 83505-1-RR (SLC17A9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse pancreas using 83505-1-RR
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 83505-1-RR (SLC17A9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 83505-1-RR
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 83505-1-RR (SLC17A9 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of Caco-2 using 83505-1-RR
1x10^6 Caco-2 cells were intracellularly stained with 0.25 ug SLC17A9 Recombinant antibody (83505-1-RR, Clone:240328H7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 83505-1-RR
Biolayer interferometry (BLl) kinetic assays of 83505-1-RR against Human SLC17A9 were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse brain tissue, rat brain tissue
Positive IHC detected in	mouse pancreas tissue, mouse liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive FC (Intra) detected in	Caco-2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:16000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83505-1-RR targets SLC17A9 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity	mouse, rat
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag24970 Product name: Recombinant human SLC17A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC025312 Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK Predict reactive species
Full Name	solute carrier family 17, member 9
Calculated Molecular Weight	436 aa, 47 kDa
Observed Molecular Weight	50 kD
GenBank Accession Number	BC025312
Gene Symbol	SLC17A9
Gene ID (NCBI)	63910
RRID	AB_3671130
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purfication
UNIPROT ID	Q9BYT1
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
FC protocol for SLC17A9 antibody 83505-1-RR	Download protocol
IHC protocol for SLC17A9 antibody 83505-1-RR	Download protocol
WB protocol for SLC17A9 antibody 83505-1-RR	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
mouse	WB,IF	Nat Commun An unconventional autophagic pathway that inhibits ATP secretion during apoptotic cell death Authors - Elena Terraza-Silvestre View Article
mouse	WB	Mol Psychiatry ATP release from the amygdala-prefrontal pathway regulates vulnerability to social stress in male mice. Authors - Ding-Yu Wu View Article