Use Able AI chat for product recommendations

SNAT2 Recombinant monoclonal antibody

SNAT2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 83968-5-RR
Clone No.241059C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

SLC38A2, 241059C6, ATA2, KIAA1382, PRO1068

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue
Positive IHC detected inmouse pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83968-5-RR targets SNAT2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag23082

Product name: Recombinant human SLC38A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-50 aa of BC040342

Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQN

Predict reactive species
Full Name solute carrier family 38, member 2
Observed Molecular Weight56 kDa
GenBank Accession NumberBC040342
Gene Symbol SLC38A2
Gene ID (NCBI) 54407
RRIDAB_3671544
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ96QD8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNAT2 (Sodium-dependent neutral amino acid transporter-2), the ubiquitous member of SLC38 family, accounts for the activity of transport system A for neutral amino acids in most mammalian tissues (PMID: 16734764). SNAT2 mediates uptake of neutral α-amino acids and are expressed in central neurons (PMID: 19240036). SNAT2 is expressed in breast cancer cell lines. SLC38A2 also acts as a selective target for inhibiting growth of Gln-dependent breast cancer cell lines (PMID: 33028955).

Protocols

Product Specific Protocols
FC protocol for SNAT2 antibody 83968-5-RRDownload protocol
IHC protocol for SNAT2 antibody 83968-5-RRDownload protocol
WB protocol for SNAT2 antibody 83968-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...