Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83968-5-RR targets SNAT2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag23082 Product name: Recombinant human SLC38A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC040342 Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQN Predict reactive species |
| Full Name | solute carrier family 38, member 2 |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC040342 |
| Gene Symbol | SLC38A2 |
| Gene ID (NCBI) | 54407 |
| RRID | AB_3671544 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q96QD8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SNAT2 (Sodium-dependent neutral amino acid transporter-2), the ubiquitous member of SLC38 family, accounts for the activity of transport system A for neutral amino acids in most mammalian tissues (PMID: 16734764). SNAT2 mediates uptake of neutral α-amino acids and are expressed in central neurons (PMID: 19240036). SNAT2 is expressed in breast cancer cell lines. SLC38A2 also acts as a selective target for inhibiting growth of Gln-dependent breast cancer cell lines (PMID: 33028955).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SNAT2 antibody 83968-5-RR | Download protocol |
| IHC protocol for SNAT2 antibody 83968-5-RR | Download protocol |
| WB protocol for SNAT2 antibody 83968-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







