• Featured Product
  • KD/KO Validated

TAF15 Recombinant monoclonal antibody

TAF15 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 82860-1-RR
Clone No.3L13

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

RNA-binding protein 56, RNA binding protein 56, RBP56, hTAFII68, 68 kDa TATA-binding protein-associated factor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse liver tissue, HEK-293 cells, Jurkat cells, MCF-7 cells, rat brain tissue
Positive IHC detected inmouse lung tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82860-1-RR targets TAF15 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20828

Product name: Recombinant human TAF15 protein

Source: e coli.-derived, PET32a

Tag: 6*His

Domain: 244-592 aa of BC046099

Sequence: GVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Predict reactive species
Full Name TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Calculated Molecular Weight 592 aa, 62 kDa
Observed Molecular Weight62-75 kDa
GenBank Accession NumberBC046099
Gene Symbol TAF15
Gene ID (NCBI) 8148
RRIDAB_3670584
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92804
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAF15 (TAF2N or TAFII68) is a nuclear protein known to associate with a distinct subpopulation of transcription factor IID (TFIID), a multi-subunit complex that nucleates the pre-initiation complex on promoters of on protein-coding genes. TAF15 harbors a transcriptional activation domain, a RNA recognition motif and many Arg-Gly-Gly repeats that participate in RNA binding. TAF15 along with FUS and EWS constitutes the FET (FUS/EWS/TAF15) protein family of heterogeneous nuclear ribonucleoproteins (hnRNPs) class of RNA binding proteins that are multifunctional proteins implicated in numerous aspects of RNA processing/functions. TAF15 is a nuclear protein that shuttle between cytoplasm-nucleus and as RNA/ssDNA-binding protein, it play specific roles during transcription initiation at distinct promoters and enter the preinitiation complex together with the RNA polymerase II. TAF15 as well as other FET member genes are frequently translocated in sarcomas and rare hematopoietic as well as epithelial cancers. Moreover, dominant mutations in genes coding for four hnRNPs (TDP-43, FUS/TLS, TAF15, and EWS) are found in familial and sporadic cases of ALS and a chromosomal aberration involving TAF15/TAF2N is found in a form of extraskeletal myxoid chondrosarcomas (EMC).

Protocols

Product Specific Protocols
IF protocol for TAF15 antibody 82860-1-RRDownload protocol
IHC protocol for TAF15 antibody 82860-1-RRDownload protocol
WB protocol for TAF15 antibody 82860-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...