• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated TAF15 Recombinant monoclonal antibody

TAF15 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-82860
Clone No.3L13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

RNA-binding protein 56, RNA binding protein 56, RBP56, hTAFII68, 68 kDa TATA-binding protein-associated factor

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82860 targets TAF15 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20828

Product name: Recombinant human TAF15 protein

Source: e coli.-derived, PET32a

Tag: 6*His

Domain: 244-592 aa of BC046099

Sequence: GVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Predict reactive species
Full Name TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Calculated Molecular Weight 592 aa, 62 kDa
Observed Molecular Weight62-75 kDa
GenBank Accession NumberBC046099
Gene Symbol TAF15
Gene ID (NCBI) 8148
RRIDAB_3673087
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92804
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TAF15 (TAF2N or TAFII68) is a nuclear protein known to associate with a distinct subpopulation of transcription factor IID (TFIID), a multi-subunit complex that nucleates the pre-initiation complex on promoters of on protein-coding genes. TAF15 harbors a transcriptional activation domain, a RNA recognition motif and many Arg-Gly-Gly repeats that participate in RNA binding. TAF15 along with FUS and EWS constitutes the FET (FUS/EWS/TAF15) protein family of heterogeneous nuclear ribonucleoproteins (hnRNPs) class of RNA binding proteins that are multifunctional proteins implicated in numerous aspects of RNA processing/functions. TAF15 is a nuclear protein that shuttle between cytoplasm-nucleus and as RNA/ssDNA-binding protein, it play specific roles during transcription initiation at distinct promoters and enter the preinitiation complex together with the RNA polymerase II. TAF15 as well as other FET member genes are frequently translocated in sarcomas and rare hematopoietic as well as epithelial cancers. Moreover, dominant mutations in genes coding for four hnRNPs (TDP-43, FUS/TLS, TAF15, and EWS) are found in familial and sporadic cases of ALS and a chromosomal aberration involving TAF15/TAF2N is found in a form of extraskeletal myxoid chondrosarcomas (EMC).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TAF15 antibody CL488-82860Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...