Tested Applications
| Positive WB detected in | LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, pig heart tissue, rabbit heart tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66149-1-Ig targets TIMM44 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2c |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21389 Product name: Recombinant human TIMM44 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 153-452 aa of BC033628 Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 44 homolog (yeast) |
| Calculated Molecular Weight | 452 aa, 51 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC033628 |
| Gene Symbol | TIMM44 |
| Gene ID (NCBI) | 10469 |
| RRID | AB_2881545 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O43615 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Translocase of inner mitochondrial membrane 44 (TIMM44), also known as MIMT44 and TIM44, belongs to the Tim44 family. TIMM44 is a mitochondrial protein located at the inner mitochondrial membrane, which is crucial for the integrity and function of mitochondria. In an ATP-dependent manner, TIMM44 anchors mitochondrial heat shock protein 70 to the translocase of the mitochondrial inner membrane 23 (TIMM23) complex. TIMM44 is essential for mitochondrial pre-protein import into the mitochondrial matrix. TIMM44 is vital for the integrity and function of mitochondria. TIMM44 silencing disrupted mitochondrial functions in endothelial cells, causing mitochondrial protein input arrest, ATP reduction, ROS production, and mitochondrial depolarization, and leading to apoptosis activation (PMID: 36438483, PMID: 37147302, PMID: 38467612). The observed molecular weight of TIMM44 is 45 kDa, indicating a mature form of TIMM44 (PMID: 33891006).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMM44 antibody 66149-1-Ig | Download protocol |
| IHC protocol for TIMM44 antibody 66149-1-Ig | Download protocol |
| WB protocol for TIMM44 antibody 66149-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TIMM44 Monoclonal antibody (4G7D4), catalog number 66149-1-Ig, has 1 total citation. The citation appears in medRxiv (2026), published by Patrick Forny et al. The study, titled "Cooperative Architecture of Mitochondrial Proteome Homeostasis," was conducted using Western blot (WB) in human samples. The research field is mitochondrial biology and proteome homeostasis.
| Species | Application | Title |
|---|---|---|
Reviews
What customers say
One verified user rated this antibody 5 stars. The reviewer successfully used it at a 1:1000 dilution for Western Blot on mitochondrial fraction lysates of ST-Hdh-Q7/Q7 mouse striatal cell lines. The protocol involved a 4–12% Bis-tris gradient gel, overnight transfer to Immobilon-FL membranes, SEA Block as the blocking buffer, and overnight primary antibody incubation at 4°C with an IRDye 800CW goat anti-mouse secondary antibody. The results were clear and reliable, confirming the antibody's performance in detecting TIM44 in mitochondrial preparations.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lana (Verified Customer) (04-20-2019) | SDS-PAGE:15 ug/ul RIPA lysate of mitochondrial fraction of ST-Hdh-Q7/Q7 mouse striatal cell line4-12% Bis-tris gradient gelTransfer:Immobilon-FL transfer membranes (Millipore), O/N at 30V, 4CBlocking:SEA Block Blocking Buffer 1hPrimary Ab:O/N incubation at 4CSecondary Ab:IRDye 800CW Goat anti-Mouse1 h incubation at room temperatureLines on WB:1. BioRad Precision Plus Protein standards2. Lysate of mitochondrial fraction of ST-Hdh-Q7/Q7 mouse striatal cell line
![]() |










