TIMM44 Monoclonal antibody, PBS Only

• 

  WB analysis using 66149-1-Ig (same clone as 66149-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66149-1-Ig (TIMM44 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66149-1-Ig (same clone as 66149-1-PBS)

  WB result of TIMM44 antibody (66149-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TIMM44 transfected HeLa cells. This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66149-1-Ig (same clone as 66149-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66149-1-Ig (TIMM44 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66149-1-Ig (same clone as 66149-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66149-1-Ig (TIMM44 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66149-1-Ig (same clone as 66149-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TIMM44 antibody (66149-1-Ig, Clone: 4G7D4 ) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TIMM44 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66149-1-PBS

Clone No.4G7D4

Host / Isotype

Mouse / IgG2c

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

4G7D4, MIMT44, TIM44, TIMM 44

---

Product Information

66149-1-PBS targets TIMM44 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2c
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21389

  Product name: Recombinant human TIMM44 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 153-452 aa of BC033628

  Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL

• Full Name: translocase of inner mitochondrial membrane 44 homolog (yeast)
• Calculated Molecular Weight: 452 aa, 51 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC033628
• Gene Symbol: TIMM44
• Gene ID (NCBI): 10469
• RRID: AB_2881545
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43615
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Translocase of inner mitochondrial membrane 44 (TIMM44), also known as MIMT44 and TIM44, belongs to the Tim44 family. TIMM44 is a mitochondrial protein located at the inner mitochondrial membrane, which is crucial for the integrity and function of mitochondria. In an ATP-dependent manner, TIMM44 anchors mitochondrial heat shock protein 70 to the translocase of the mitochondrial inner membrane 23 (TIMM23) complex. TIMM44 is essential for mitochondrial pre-protein import into the mitochondrial matrix. TIMM44 is vital for the integrity and function of mitochondria. TIMM44 silencing disrupted mitochondrial functions in endothelial cells, causing mitochondrial protein input arrest, ATP reduction, ROS production, and mitochondrial depolarization, and leading to apoptosis activation (PMID: 36438483, PMID: 37147302, PMID: 38467612). The observed molecular weight of TIMM44 is 45 kDa, indicating a mature form of TIMM44 (PMID: 33891006).