TIMM44 Monoclonal antibody, PBS Only

• 

  WB analysis using 66149-1-Ig (same clone as 66149-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66149-1-Ig (TIMM44 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66149-1-Ig (same clone as 66149-1-PBS)

  WB result of TIMM44 antibody (66149-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TIMM44 transfected HeLa cells. This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66149-1-Ig (same clone as 66149-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66149-1-Ig (TIMM44 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66149-1-Ig (same clone as 66149-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66149-1-Ig (TIMM44 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66149-1-Ig (same clone as 66149-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TIMM44 antibody (66149-1-Ig, Clone: 4G7D4 ) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66149-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TIMM44 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66149-1-PBS

Clone No.4G7D4

Host / Isotype

Mouse / IgG2c

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

4G7D4, MIMT44, TIM44, TIMM 44

---

Product Information

66149-1-PBS targets TIMM44 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2c
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21389

  Product name: Recombinant human TIMM44 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 153-452 aa of BC033628

  Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL

• Full Name: translocase of inner mitochondrial membrane 44 homolog (yeast)
• Calculated Molecular Weight: 452 aa, 51 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC033628
• Gene Symbol: TIMM44
• Gene ID (NCBI): 10469
• RRID: AB_2881545
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43615
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.