TNFSF15 Recombinant monoclonal antibody

TNFSF15 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 83700-3-RR
Clone No.251018A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

TNFSF 15, Tumor necrosis factor ligand superfamily member 15, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand superfamily member 15, secreted form

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse colon tissue, rat colon tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83700-3-RR targets TNFSF15 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg32092

Product name: Recombinant Human TL1A/TNFSF15 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: N-6*his

Domain: 72-251 aa of BC074941

Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 15
Calculated Molecular Weight 28 kDa
Observed Molecular Weight28 kDa
GenBank Accession NumberBC074941
Gene Symbol TNFSF15
Gene ID (NCBI) 9966
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95150
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tumor necrosis factor ligand superfamily member 15 (TNFSF15) is also named as TL1 and VEGI. And it belongs to the tumor necrosis factor family. It is a receptor for TNFRSF25 and TNFRSF6B. VEGI induced degradation of IκB alpha, and nuclear translocation of p65 subunit of NFκB by activating NFκB (PMID: 10597252). TL1A mediates activation and apoptosis of NFκB in DR3-expressing cell lines (PMID: 11911831). Overexpression by cancer cells of a secretable VEGI fusion protein resulted in abrogation of xenograft tumor progression. The isoforms show endothelial cell-specific expression and are generated from a 17 kb human gene by alternative splicing (PMID: 11923219). In addition, VEGI can inhibit vascular endothelial growth and angiogenesis (in vitro) (PMID: 9872942).

Protocols

Product Specific Protocols
WB protocol for TNFSF15 antibody 83700-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...