Tested Applications
| Positive WB detected in | HeLa cells, L02 cells, BGC-823 cells, human heart tissue, mouse skeletal muscle tissue, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14208-1-AP targets TRIM24 in WB, IHC, IF/ICC, IP, CoIP, chIP, RIP, ELISA, CUT&Tag applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5417 Product name: Recombinant human TRIM24 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 701-1050 aa of BC028689 Sequence: SKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK Predict reactive species |
| Full Name | tripartite motif-containing 24 |
| Calculated Molecular Weight | 117 kDa |
| Observed Molecular Weight | 117 kDa |
| GenBank Accession Number | BC028689 |
| Gene Symbol | TRIM24 |
| Gene ID (NCBI) | 8805 |
| RRID | AB_2256646 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15164 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM24, also named as RNF82, TIF1 and TIF1A, interacts selectively in vitro with the AF2-activating domain of the estrogen receptors. Association with DNA-bound estrogen receptors, it requires the presence of estradiol. It is a regulation protein of P53. Defects in TRIM24 are a cause of thyroid papillary carcinoma (TPC) wich is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRIM24 antibody 14208-1-AP | Download protocol |
| IHC protocol for TRIM24 antibody 14208-1-AP | Download protocol |
| IP protocol for TRIM24 antibody 14208-1-AP | Download protocol |
| WB protocol for TRIM24 antibody 14208-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
TRIM24 antibody (Cat# 14208-1-AP) has accumulated 58 citations in journals including Nature, Nature Communications, Molecular Cell, Cell Death & Differentiation, Oncogene, and Journal of Experimental Medicine. Research fields encompass epigenetics and chromatin biology, multiple cancer types (breast, glioblastoma, prostate, colorectal, gastric, lung), immune and inflammatory signaling, HIV latency, cardiology, neurodegeneration, glucose metabolism, and programmed cell death pathways including autophagy, ferroptosis, and pyroptosis.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Epigenetic programming by H3K23ac defines lineage fate of Meg3+ haematopoietic stem cells and drives immune ageing | ||
Cancer Res Histone Acetyltransferase KAT6A Upregulates PI3K/AKT Signaling through TRIM24 Binding. | ||
Nat Commun Mammary-specific expression of Trim24 establishes a mouse model of human metaplastic breast cancer. |
Reviews
What customers say
The product has received one review. Parijat Sarkar rated it 5 stars on September 20, 2023, after using it for Western Blot with lot 00026063. The reviewer described it as a "good antibody for Western," indicating a positive experience with the product's performance in that application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Parijat (Verified Customer) (09-20-2023) | Good antibody for Western
|
