Tested Applications
| Positive WB detected in | HeLa cells, Transfected HEK-293 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue, human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15176-1-AP targets Gamma Tubulin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7070 Product name: Recombinant human tubulin-gamma protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 103-451 aa of BC000619 Sequence: NWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Predict reactive species |
| Full Name | tubulin, gamma 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC000619 |
| Gene Symbol | Gamma Tubulin |
| Gene ID (NCBI) | 7283 |
| RRID | AB_2878113 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23258 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IF protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IHC protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IP protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| WB protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Gamma Tubulin Polyclonal antibody (Cat# 15176-1-AP) has 29 citations across 26 journals, including Nature Communications, Cancer Cell, eLife, PLoS Biology, EMBO Reports, and Cell Death & Differentiation. Research fields span centrosome and spindle biology, ciliopathies, cell cycle regulation, cancer (breast, prostate, liver, bladder), developmental disorders, neurodegeneration, and virology.
| Species | Application | Title |
|---|---|---|
Nat Commun CRISPR screens reveal convergent targeting strategies against evolutionarily distinct chemoresistance in cancer | ||
Nat Commun INTS13 variants causing a recessive developmental ciliopathy disrupt assembly of the Integrator complex | ||
J Nanobiotechnology GRP75-driven, cell-cycle-dependent macropinocytosis of Tat/pDNA-Ca2+ nanoparticles underlies distinct gene therapy effect in ovarian cancer. | ||
Cell Death Differ Haploinsufficiency of GCP4 induces autophagy and leads to photoreceptor degeneration due to defective spindle assembly in retina. | ||
Br J Pharmacol NL13, a novel curcumin analogue and polo like kinase 4 inhibitor, induces cell cycle arrest and apoptosis in prostate cancer models |
Reviews
What customers say
All four reviews are 5-star ratings. Users report excellent performance for both Western Blot and Immunofluorescence applications, with one noting it works well with overnight incubation at 1:1000 dilution and another confirming good IF results at 1:500 on methanol-fixed cells. One customer also praised the fast shipping speed. Overall, reviewers express strong satisfaction with the product's reliability and results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Deng (Verified Customer) (07-22-2022) | The cells were fixed with cold methanol.
 |
Iru (Verified Customer) (06-17-2021) | It works well with O/N incubation.
 |
Christopher (Verified Customer) (07-02-2019) | Very fast delivery I think it arrived in a matter of days which is quick compared to some other companies.Westerns worked really well, so it must be good, over all really pleased with this purchase
|
Boyan (Verified Customer) (01-29-2019) | Excellent. Works quite well both for WB and IF.
|
