Tested Applications
| Positive WB detected in | HeLa cells, Transfected HEK-293 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue, human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15176-1-AP targets Gamma Tubulin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7070 Product name: Recombinant human tubulin-gamma protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 103-451 aa of BC000619 Sequence: NWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Predict reactive species |
| Full Name | tubulin, gamma 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC000619 |
| Gene Symbol | Gamma Tubulin |
| Gene ID (NCBI) | 7283 |
| RRID | AB_2878113 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23258 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IF protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IHC protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IP protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| WB protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Gamma Tubulin Polyclonal antibody (Cat# 15176-1-AP) has 29 citations across 26 journals including Nature Communications, Cancer Cell, eLife, PLoS Biology, EMBO Reports, Cell Death & Differentiation, and Journal of Cell Science. Research fields span centrosome biology, spindle assembly, ciliogenesis, microtubule dynamics, cell cycle regulation, cancer (breast, prostate, bladder, liver), developmental disorders, and viral infections.
| Species | Application | Title |
|---|---|---|
Nat Commun INTS13 variants causing a recessive developmental ciliopathy disrupt assembly of the Integrator complex | ||
Nat Commun CRISPR screens reveal convergent targeting strategies against evolutionarily distinct chemoresistance in cancer | ||
J Nanobiotechnology GRP75-driven, cell-cycle-dependent macropinocytosis of Tat/pDNA-Ca2+ nanoparticles underlies distinct gene therapy effect in ovarian cancer. | ||
Cell Death Differ Haploinsufficiency of GCP4 induces autophagy and leads to photoreceptor degeneration due to defective spindle assembly in retina. | ||
Br J Pharmacol NL13, a novel curcumin analogue and polo like kinase 4 inhibitor, induces cell cycle arrest and apoptosis in prostate cancer models |
Reviews
What customers say
All four reviewers gave this product a perfect 5-star rating. Users report excellent performance in both Western Blot and Immunofluorescence applications. One reviewer confirmed successful IF staining on human RPE1 cells at a 1:500 dilution using cold methanol fixation, while another noted reliable WB results on fallopian tube epithelial cells at 1:1000 with overnight incubation. Additional feedback highlights fast shipping and overall satisfaction with the purchase. No negative comments were reported across the reviews.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Deng (Verified Customer) (07-22-2022) | The cells were fixed with cold methanol.
 |
Iru (Verified Customer) (06-17-2021) | It works well with O/N incubation.
 |
Christopher (Verified Customer) (07-02-2019) | Very fast delivery I think it arrived in a matter of days which is quick compared to some other companies.Westerns worked really well, so it must be good, over all really pleased with this purchase
|
Boyan (Verified Customer) (01-29-2019) | Excellent. Works quite well both for WB and IF.
|
