TYRO3 Recombinant monoclonal antibody

TYRO3 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 84929-6-RR
Clone No.242477G1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

RSE, EC:2.7.10.1, Dtk, BYK, Brt

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:125-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84929-6-RR targets TYRO3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29527

Product name: Recombinant human TYRO3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 451-596 aa of BC049368

Sequence: LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL

Predict reactive species
Full Name TYRO3 protein tyrosine kinase
Calculated Molecular Weight 97 kDa
Observed Molecular Weight130 kDa
GenBank Accession NumberBC049368
Gene Symbol TYRO3
Gene ID (NCBI) 7301
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ06418
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TYRO3 has a structure includes a cytoplasmic domain and an extracellular ligand binding region. And ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. TYRO3 is associated with many physiological processes including cell survival, migration and differentiation. It has been reported that TYRO3 can be expressed in various regions of the mammalian central nervous system. The molecular mass of TYRO3 is 130 kDa, the apparent molecular mass is higher due to glycosylation.((PMID: 8873131, 23354874, 21539887)

Protocols

Product Specific Protocols
IHC protocol for TYRO3 antibody 84929-6-RRDownload protocol
WB protocol for TYRO3 antibody 84929-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...