Tested Applications
| Positive IHC detected in | human colon tissue, rat small intestine tissue, mouse brain tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue |
| Positive IF/ICC detected in | HT-29 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16233-1-AP targets VIP in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8933 Product name: Recombinant human VIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-169 aa of BC009794 Sequence: YRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK Predict reactive species |
| Full Name | vasoactive intestinal peptide |
| Calculated Molecular Weight | 169 aa, 19 kDa |
| GenBank Accession Number | BC009794 |
| Gene Symbol | VIP |
| Gene ID (NCBI) | 7432 |
| RRID | AB_2878233 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01282 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Vasoactive intestinal peptide (VIP), a short peptide containing 28 amino acids belonging to the secretin-glucagon family, is initially isolated from the gastrointestinal tract as a potent vasodilator peptide. VIP was initially identified in normal nervous tissue and neurons and was subsequently recognized as a neurotransmitter widely distributed in various tissues. The wide distribution of VIP determines its involvement in a range of biological activities, such as gut motility, hormonal regulation, circadian rhythms, immune responses, and carcinogenesis. The general physiologic effects of VIP include vasodilation, anti-inflammatory actions, cell proliferation, hormonal secretion, regulation of gastric motility, and smooth muscle relaxation; therefore, VIP has emerged as a promising drug candidate for the treatment of several diseases.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VIP antibody 16233-1-AP | Download protocol |
| IHC protocol for VIP antibody 16233-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VIP Polyclonal antibody (Cat# 16233-1-AP) has 9 citations published in journals including Nature Communications, ACS Nano, Neuron, Cell Reports, Pharmaceutical Biology, Biomolecules, Immunity and Inflammation Disease, Journal of Neuroscience Research, and Neurochemistry International. Associated research fields span immunology (asthma, humoral immunity), neuroscience (synaptic plasticity, sensory learning, itch behavior), endocrinology (insulin secretion), regenerative medicine (tendon repair), and autoimmune disease (Sjögren's syndrome).
| Species | Application | Title |
|---|---|---|
Nat Commun Sensory neurons regulate stimulus-dependent humoral immunity in mouse models of bacterial infection and asthma | ||
ACS Nano Nanoparticle-Driven Tendon Repair: Role of Vasoactive Intestinal Peptide in Immune Modulation and Stem Cell Enhancement. | ||
Neuron Dynamic redistribution of AMPA receptors toward memory-related neuronal ensembles in mice barrel cortex during sensory learning | ||
Pharm Biol Modified BuShenYiQi formula alleviates experimental allergic asthma in mice by negative regulation of type 2 innate lymphoid cells and CD4 + type 9 helper T cells and the VIP-VPAC2 signalling pathway | ||
Biomolecules Postweaning Development Influences Endogenous VPAC1 Modulation of LTP Induced by Theta-Burst Stimulation: A Link to Maturation of the Hippocampal GABAergic System |
Reviews
What customers say
The single review for this product is from a user who tested it for immunofluorescence on human brain cortex paraffin sections at a 1:100 dilution. They reported that VIP (shown in red) worked nicely, giving them a 5-star rating. Overall, the feedback is positive, confirming reliable performance in IF applications on human tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Reyes (Verified Customer) (03-01-2024) | VIP (in red) worked nicely on IF in human paraffin brain sections.
 |
