Use Able AI chat for product recommendations

VIP Polyclonal antibody

VIP Polyclonal Antibody for IHC, IF/ICC, IF-P, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Intestinal peptide PHM-27, Intestinal peptide PHV-42, VIP peptides

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for VIP in ?

Tested Applications

Positive IHC detected inhuman colon tissue, rat small intestine tissue, mouse brain tissue, human small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue
Positive IF/ICC detected inHT-29 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16233-1-AP targets VIP in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8933

Product name: Recombinant human VIP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 29-169 aa of BC009794

Sequence: YRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Predict reactive species
Full Name vasoactive intestinal peptide
Calculated Molecular Weight 169 aa, 19 kDa
GenBank Accession NumberBC009794
Gene Symbol VIP
Gene ID (NCBI) 7432
RRIDAB_2878233
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01282
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vasoactive intestinal peptide (VIP), a short peptide containing 28 amino acids belonging to the secretin-glucagon family, is initially isolated from the gastrointestinal tract as a potent vasodilator peptide. VIP was initially identified in normal nervous tissue and neurons and was subsequently recognized as a neurotransmitter widely distributed in various tissues. The wide distribution of VIP determines its involvement in a range of biological activities, such as gut motility, hormonal regulation, circadian rhythms, immune responses, and carcinogenesis. The general physiologic effects of VIP include vasodilation, anti-inflammatory actions, cell proliferation, hormonal secretion, regulation of gastric motility, and smooth muscle relaxation; therefore, VIP has emerged as a promising drug candidate for the treatment of several diseases.

Protocols

Product Specific Protocols
IF protocol for VIP antibody 16233-1-APDownload protocol
IHC protocol for VIP antibody 16233-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The VIP Polyclonal antibody (Cat# 16233-1-AP) has 9 citations published in journals including Nature Communications, ACS Nano, Neuron, Cell Reports, Pharmaceutical Biology, Biomolecules, Immunity and Inflammation Disease, Journal of Neuroscience Research, and Neurochemistry International. Associated research fields span immunology (asthma, humoral immunity), neuroscience (synaptic plasticity, sensory learning, itch behavior), endocrinology (insulin secretion), regenerative medicine (tendon repair), and autoimmune disease (Sjögren's syndrome).

SpeciesApplicationTitle
mouse

Nat Commun

Sensory neurons regulate stimulus-dependent humoral immunity in mouse models of bacterial infection and asthma

Authors - Diane Aguilar
ratELISA

ACS Nano

Nanoparticle-Driven Tendon Repair: Role of Vasoactive Intestinal Peptide in Immune Modulation and Stem Cell Enhancement.

Authors - Hao Wang
mouseIF

Neuron

Dynamic redistribution of AMPA receptors toward memory-related neuronal ensembles in mice barrel cortex during sensory learning

Authors - Junzhao Li
mouseIF

Cell Rep

PMID: 31509750

Authors - Jing Xue
mouseIF

Pharm Biol

Modified BuShenYiQi formula alleviates experimental allergic asthma in mice by negative regulation of type 2 innate lymphoid cells and CD4 + type 9 helper T cells and the VIP-VPAC2 signalling pathway

Authors - Muhua Huang
ratWB

Biomolecules

Postweaning Development Influences Endogenous VPAC1 Modulation of LTP Induced by Theta-Burst Stimulation: A Link to Maturation of the Hippocampal GABAergic System

Authors - Marta Gil

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product is from a user who tested it for immunofluorescence on human brain cortex paraffin sections at a 1:100 dilution. They reported that VIP (shown in red) worked nicely, giving them a 5-star rating. Overall, the feedback is positive, confirming reliable performance in IF applications on human tissue.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Reyes (Verified Customer) (03-01-2024)

VIP (in red) worked nicely on IF in human paraffin brain sections.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
VIP Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:16233-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...