CoraLite® Plus 488-conjugated VIP Polyclonal antibody

VIP Polyclonal Antibody for IF-P
Cat No. CL488-16233

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

PHM27, vasoactive intestinal peptide, VIP, VIP peptides

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse colon tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16233 targets VIP in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8933

Product name: Recombinant human VIP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 29-169 aa of BC009794

Sequence: YRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Predict reactive species
Full Name vasoactive intestinal peptide
Calculated Molecular Weight 169 aa, 19 kDa
GenBank Accession NumberBC009794
Gene Symbol VIP
Gene ID (NCBI) 7432
RRIDAB_3083986
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01282
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Vasoactive intestinal peptide (VIP), a short peptide containing 28 amino acids belonging to the secretin-glucagon family, is initially isolated from the gastrointestinal tract as a potent vasodilator peptide. VIP was initially identified in normal nervous tissue and neurons and was subsequently recognized as a neurotransmitter widely distributed in various tissues. The wide distribution of VIP determines its involvement in a range of biological activities, such as gut motility, hormonal regulation, circadian rhythms, immune responses, and carcinogenesis. The general physiologic effects of VIP include vasodilation, anti-inflammatory actions, cell proliferation, hormonal secretion, regulation of gastric motility, and smooth muscle relaxation; therefore, VIP has emerged as a promising drug candidate for the treatment of several diseases.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 VIP antibody CL488-16233Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...