ZAK Recombinant monoclonal antibody

ZAK Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 81161-2-RR
Clone No.250559E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

AZK, EC:2.7.11.25, HCCS 4, HCCS-4, Leucine zipper- and sterile alpha motif-containing kinase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse skeletal muscle tissue, Jurkat cells, MDA-MB-231 cells, HEK-293 cellls, U2OS cells, rat skeletal muscle tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81161-2-RR targets ZAK in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30599

Product name: Recombinant human ZAK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 223-325 aa of BC001401

Sequence: ERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQ

Predict reactive species
Full Name sterile alpha motif and leucine zipper containing kinase AZK
Calculated Molecular Weight 91 kDa
Observed Molecular Weight91kDa, 51 kDa
GenBank Accession NumberBC001401
Gene Symbol ZAK
Gene ID (NCBI) 51776
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NYL2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZAK(sterile-alpha motif and leucine zipper containing kinase AZK) is also named as MLTK, MAPKKK, mlklak, MLK7, AZK, MLT, MRK, HCCS-4, MAP3K20 and belongs to the MAPKKK family. It is a mitogen-activated protein kinase kinase kinase (MAP3K) that activates the stress-activated protein kinase/c-jun N-terminal kinase pathway and activates NF-kappaB. ZAK contributes to regulation of DNA damage checkpoints through a p38 gamma-independent pathway. This protein has 3 isoforms produced by alternative splicing with the MW of 91 kDa (ZAK alpha), 51 kDa (ZAK beta) and 35 kDa.

Protocols

Product Specific Protocols
WB protocol for ZAK antibody 81161-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...