cIAP2 Recombinant monoclonal antibody

cIAP2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA
Cat No. 84779-4-RR
Clone No.242214E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), IP, ELISA

BIRC3, 242214E11, Baculoviral IAP repeat-containing protein 3, BIRC 3, C IAP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDaudi cells, Raji cells
Positive IP detected inRaji cells
Positive FC (Intra) detected inRaji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84779-4-RR targets cIAP2 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20500

Product name: Recombinant human BIRC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 78-169 aa of BC027485

Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE

Predict reactive species
Full Name baculoviral IAP repeat-containing 3
Calculated Molecular Weight 604 aa, 68 kDa
Observed Molecular Weight68 kDa
GenBank Accession NumberBC027485
Gene Symbol cIAP2
Gene ID (NCBI) 330
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ13489
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

cIAP2 also known as BIRC3, is a member of the Inhibitor of Apoptosis Protein (IAP) family. cIAP2 is induced by inflammatory stimuli and plays a critical role in regulating adaptive and innate immune responses, cell death, and the production of inflammatory mediators. Its dysregulation is associated with various diseases, including cancer and neuroinflammatory conditions. Understanding the mechanisms by which cIAP2 functions and interacts with other cellular components is essential for developing targeted therapies.

Protocols

Product Specific Protocols
FC protocol for cIAP2 antibody 84779-4-RRDownload protocol
IP protocol for cIAP2 antibody 84779-4-RRDownload protocol
WB protocol for cIAP2 antibody 84779-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...