Tested Applications
| Positive WB detected in | Jurkat cells, HepG2 cells, HeLa cells, HEK-293 cells, K-562 cells, NIH/3T3 cells, RAW 264.7 cells, PC-12 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells, A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
80821-2-RR targets p38 MAPK in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag5115 Product name: Recombinant human p38 MAPK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-307 aa of BC031574 Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY Predict reactive species |
| Full Name | mitogen-activated protein kinase 14 |
| Calculated Molecular Weight | 360 aa, 41 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC031574 |
| Gene Symbol | p38 MAPK |
| Gene ID (NCBI) | 1432 |
| RRID | AB_3670489 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q16539 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for p38 MAPK antibody 80821-2-RR | Download protocol |
| IHC protocol for p38 MAPK antibody 80821-2-RR | Download protocol |
| IP protocol for p38 MAPK antibody 80821-2-RR | Download protocol |
| WB protocol for p38 MAPK antibody 80821-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol A novel triazole derivative ameliorates ethanol-induced gastric ulcer via a NOS2-centered inhibition of the AGE-RAGE pathway. | ||
Int J Biol Macromol Isolation, structural characterization and immunoregulatory activity of a novel acidic polysaccharide from Ganoderma sinense. | ||
Int J Radiat Biol N-CWS promotes the repair of radiation-induced skin injury by enhancing angiogenesis. | ||
Int J Ophthalmol Chinese medicine formula "Qingxuan Runmu Yin" alleviating ocular surface inflammation in a rat model of dry eye disease by modulating the TLR4/TAK1/p38MAPK pathway. | ||
Transl Cancer Res PRSS1 promotes gastric cancer invasion and metastasis by induction of the epithelial-mesenchymal transition and activation of the MAPK/ERK pathway. | ||
Mater Today Bio An intelligent tribological hydrogel delivering 9,10-DiOH activates cuproptosis for comprehensive rheumatoid arthritis intervention. |

















