Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, MOLT-4 cells, Jurkat cells, Raji cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 266 publications below |
| IHC | See 18 publications below |
| IF | See 43 publications below |
| CoIP | See 2 publications below |
| ChIP | See 3 publications below |
| RIP | See 1 publications below |
Product Information
66535-1-Ig targets NF-κB p65 in WB, IHC, IF, CoIP, ChIP, RIP, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, pig, chicken, bovine, hamster |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1199 Product name: Recombinant human p65; RELA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011603 Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ Predict reactive species |
| Full Name | v-rel reticuloendotheliosis viral oncogene homolog A (avian) |
| Calculated Molecular Weight | 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC011603 |
| Gene Symbol | NF-κB p65 |
| Gene ID (NCBI) | 5970 |
| RRID | AB_2881898 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q04206 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear factor k B (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-Kb family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-Kb. The p65 subunit is a major component of NF-Kb complexes and is responsible for trans-activation. NF-kappa-B heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kappa-B p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of I-kappa-B upon NF-kappa-B the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. It associates with chromatin at the NF-kappa-B promoter region via association with DDX1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NF-κB p65 antibody 66535-1-Ig | Download protocol |
| IHC protocol for NF-κB p65 antibody 66535-1-Ig | Download protocol |
| WB protocol for NF-κB p65 antibody 66535-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Elevated SPARC Disrupts the Intestinal Barrier Integrity in Crohn's Disease by Interacting with OTUD4 and Activating the MYD88/NF-κB Pathway | ||
Brain Behav Immun Egln3 expression in microglia enhances the neuroinflammatory responses in Alzheimer's disease | ||
Adv Healthc Mater Colon-Targeted Ginseng Polysaccharides-Based Microspheres for Improving Ulcerative Colitis via Anti-Inflammation and Gut Microbiota Modulation | ||
Cell Rep METTL3-mediated m6A mRNA methylation regulates neutrophil activation through targeting TLR4 signaling | ||
Theranostics Prussian blue nanozyme-mediated nanoscavenger ameliorates acute pancreatitis via inhibiting TLRs/NF-κB signaling pathway. | ||
Int J Biol Macromol METTL3 enhances E. coli F18 resistance by targeting IKBKG/NF-κB signaling via an m6A-YTHDF1-dependent manner in IPEC-J2 cells |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Udesh (Verified Customer) (04-19-2023) | Lowest membrane part has NF-kB p65 in U2OS cells
 |
FH Federica (Verified Customer) (01-16-2023) | The band comes out well even when low total protein concentration is loaded (15 ug).
|
