• Featured Product
  • KD/KO Validated

NF-κB p65 Polyclonal antibody

The NF-κB p65 polyclonal antibody (10745-1-AP) is one of the most highly cited NF-κB p65 antibodies in the market. It is suitable for WB, IHC, IF/ICC, IP, ELISA and has been referenced in over 1,771 publications.
Cat No. 10745-1-AP
Publications(1771)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

NF κB, p65, p65; RELA, RELA, NF Kappa B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, Jurkat cells, MCF-7 cells, K-562 cells, Hek-293 cells, HeLa cells, Raji cells, NIH/3T3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman breast cancer tissue, human colon tissue, human liver cancer tissue, human stomach tissue, mouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, TNF alpha treated HT-1080 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10745-1-AP targets NF-κB p65 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, monkey, chicken, zebrafish, sheep, goat, fish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1199

Product name: Recombinant human p65; RELA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-220 aa of BC011603

Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ

Predict reactive species
Full Name v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Calculated Molecular Weight 65 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC011603
Gene Symbol NF-κB p65
Gene ID (NCBI) 5970
RRIDAB_2178878
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ04206
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear factor k B (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human RELA.

Protocols

Product Specific Protocols
IF protocol for NF-κB p65 antibody 10745-1-APDownload protocol
IHC protocol for NF-κB p65 antibody 10745-1-APDownload protocol
IP protocol for NF-κB p65 antibody 10745-1-APDownload protocol
WB protocol for NF-κB p65 antibody 10745-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Blood

Platelet NLRP6 protects against microvascular thrombosis in sepsis

Authors - Huimin Jiang
mouseWB

Bioact Mater

Silicate ions as soluble form of bioactive ceramics alleviate aortic aneurysm and dissection

Authors - Yumei Que
mouseIF

Blood

PMID: 32291445

Authors - Kunpeng Wu
mouseWB

Mol Cell

Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation

Authors - Chuanlong Wang
humanWB

Nat Microbiol

IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection.

Authors - Zhimin Jiang
mouseWB

Adv Sci (Weinh)

Reprogramming Lung Redox Homeostasis by NIR Driven Ultra-Small Pd Loaded Covalent Organic Framework Inhibits NF-κB Pathway for Acute Lung Injury Immunotherapy

Authors - Doudou Lei

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Vignesh (Verified Customer) (11-18-2025)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: THP-1 CELLS
FH

Maximilian (Verified Customer) (06-30-2023)

Quite a bit of unspecific binding. Did not work in mouse cell lines.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mainly Human Breast Cancer Cell lines (MDA-MB-436, MDA-MB-468, MDA-MB-231)
FH

Xie (Verified Customer) (09-29-2022)

NF-κB p65 Antibody staining.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: hela
NF-κB p65 Antibody Immunofluorescence validation (1:250 dilution) in hela (Cat no:10745-1-AP)
FH

Murali (Verified Customer) (01-24-2022)

Very nice antibody for IHC

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1 to 200
  • Cell Tissue Type: pharyngeal mucosal
NF-κB p65 Antibody Immunohistochemistry validation (1 to 200 dilution) in pharyngeal mucosal (Cat no:10745-1-AP)
FH

Azita (Verified Customer) (05-31-2021)

NSC-34 cells (motor neuron-like cells) strong labelling in WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/2000
  • Cell Tissue Type: Human spinal cord (cervical) tissue
FH

Zehua (Verified Customer) (12-17-2019)

After siRNA treatment for 48 hours, specific signal shown here. Works excellent!

  • Applications: Western Blot, Cell culture,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: K562
NF-κB p65 Antibody Western Blot,Cell culture, validation (1:1000 dilution) in K562 (Cat no:10745-1-AP)
FH

Feng-qian (Verified Customer) (12-07-2018)

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: HaCaT
FH

Fraser (Verified Customer) (06-06-2018)

  • Applications: Other (please state below),
Loading...
||
New chat Able
正在加载,请稍候...