Use Able AI chat for product recommendations

Gamma Tubulin Polyclonal antibody

This Gamma Tubulin antibody is a rabbit polyclonal antibody that targets Gamma Tubulin in WB, IHC, IF/ICC, ELISA and is suitable for human, mouse, canine samples.

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, canine

Applications

WB, IHC, IF/ICC, ELISA

TUBG1, Tubulin gamma 1 chain, TUBG, GCP-1, Gamma-tubulin complex component 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Gamma Tubulin in ?

Tested Applications

Positive WB detected inmouse brain tissue, HeLa cells
Positive IHC detected inhuman skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inC2C12 cells, MDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26195-1-AP targets Gamma Tubulin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, canine samples.

Tested Reactivity human, mouse, canine
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23575

Product name: Recombinant human tubulin-gamma protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 150-451 aa of BC000619

Sequence: GSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ

Predict reactive species
Full Name tubulin, gamma 1
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC000619
Gene Symbol Gamma Tubulin
Gene ID (NCBI) 7283
RRIDAB_2880420
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23258
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.

Protocols

Product Specific Protocols
IF protocol for Gamma Tubulin antibody 26195-1-APDownload protocol
IHC protocol for Gamma Tubulin antibody 26195-1-APDownload protocol
WB protocol for Gamma Tubulin antibody 26195-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Gamma Tubulin Polyclonal antibody (Cat# 26195-1-AP) has 2 total citations. These citations appear in Proceedings of the National Academy of Sciences (PNAS) and Scientific Reports. The associated research fields include developmental biology (growth plate stem cell regulation by growth hormone) and neuroscience (cerebral ischemia-reperfusion injury and microglial M2 polarization via the Nrf2/HO-1 pathway).

SpeciesApplicationTitle
mouseIF

Proc Natl Acad Sci U S A

Growth hormone regulates the stem cell population in the growth plate.

Authors - Nelson Tsz

Sci Rep

Epigallocatechin-3-gallate mitigates cerebral ischemia-reperfusion injury by promoting microglia toward M2 phenotype via Nrf2/HO-1 pathway.

Authors - Yan Zhang
Loading...
||
New chat

Able™

正在加载,请稍候...