ACSL5 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ACSL5 Recombinant monoclonal antibody (86982-1-RR)

ACSL5 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86982-1-RR Copied!

Clone No. 252098G2

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ACSL 5, Arachidonate--CoA ligase, EC:6.2.1.15, EC:6.2.1.3, FACL5

• 

  WB analysis of rat liver using 86982-1-RR

  rat liver tissue were subjected to SDS PAGE followed by western blot with 86982-1-RR (ACSL5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 86982-1-RR

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 86982-1-RR (ACSL5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 86982-1-RR

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 86982-1-RR (ACSL5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 86982-1-RR

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 86982-1-RR (ACSL5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86982-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86982-1-RR against Human ACSL5 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ACSL5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat liver tissue, mouse liver tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86982-1-RR targets ACSL5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8258

  Product name: Recombinant human ACSL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 388-739 aa of BC007985

  Sequence: DIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD

• Full Name: acyl-CoA synthetase long-chain family member 5
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC007985
• Gene Symbol: ACSL5
• Gene ID (NCBI): 51703
• RRID: AB_3745254
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULC5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACSL5 (acyl-CoA synthetase long-chain family member 5) is a gene encoding an enzyme that activates long-chain fatty acids into acyl-CoA esters, thereby directing them toward lipid synthesis or β-oxidation. It is predominantly expressed in the small intestine, uterus, and spleen, with minimal presence in normal brain tissue. ACSL5 has gained clinical attention for its marked upregulation in malignant gliomas, where it promotes fatty-acid-driven tumor growth, and its mutations are linked to congenital diarrhea (DIAR13). Additionally, its expression levels are being explored as prognostic markers in colorectal cancer and as modulators of apoptotic signaling.