Use Able AI chat for product recommendations
  • Site-specific conjugation

CoraLite®594 Anti-Human CD81 Rabbit scFv Antibody

CD81 Recombinant Antibody for FC

Cat No. CL594-SF98202
Clone No.241722G4

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

26 kDa cell surface protein TAPA-1, CD81 antigen, CD81 molecule, S5.7, TAPA1

Formulation:  HEPES, EDTA, CHAPS, Sucrose, Proclin300
HEPES, EDTA, CHAPS, Sucrose, Proclin300
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-SF98202 targets CD81 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Type Rabbit / scFv
Class Recombinant
Type Single-chain variable fragment antibody (scFv)
Immunogen

CatNo: Eg1036

Product name: recombinant human CD81 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*His

Domain: 113-201 aa of NM_004356.4

Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Predict reactive species
Full Name CD81 molecule
Calculated Molecular Weight26 kDa
GenBank Accession NumberNM_004356.4
Gene Symbol CD81
Gene ID (NCBI) 975
ENSEMBL Gene IDENSG00000110651
RRIDAB_3748520
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
SourceAnti-Human CD81 scFv from clone 241722G4, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
FormLiquid
Purification MethodAffinity purification
Storage Buffer 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934).

Protocols

Product Specific Protocols
FC protocol for CL594 CD81 antibody CL594-SF98202Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...