CoraLite® Plus 488 Anti-Human CD81 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488 Anti-Human CD81 Rabbit scFv Antibody (CL488-SF98202)

• Site-specific conjugation

CD81 Recombinant Antibody for FC

Cat No. CL488-SF98202

Clone No.241722G4

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

26 kDa cell surface protein TAPA-1, CD81 antigen, CD81 molecule, S5.7, TAPA1

• 

  FC experiment of human PBMCs using CL488-SF98202

  1x10^6 human PBMCs were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Human CD81 Rabbit scFv Antibody (CL488-SF98202, Clone: 241722G4) or 0.25 ug Isotype Control. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL488-SF98202

  1x10^6 human PBMCs were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Human CD81 Rabbit scFv Antibody (CL488-SF98202, Clone: 241722G4) (red) or 0.25 ug Isotype Control (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-SF98202 targets CD81 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg1036

  Product name: recombinant human CD81 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 113-201 aa of NM_004356.4

  Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

• Full Name: CD81 molecule
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: NM_004356.4
• Gene Symbol: CD81
• Gene ID (NCBI): 975
• ENSEMBL Gene ID: ENSG00000110651
• RRID: AB_3748007
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Source: Anti-Human CD81 scFv from clone 241722G4, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: PBS with 4% sucrose and 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934).