Product Information
86948-1-PBS targets Cathepsin S in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25881 Product name: Recombinant human CTSS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 179-296 aa of BC002642 Sequence: GCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLV Predict reactive species |
| Full Name | cathepsin S |
| Calculated Molecular Weight | 37 kDa |
| Observed Molecular Weight | 25 kDa, 37 kDa |
| GenBank Accession Number | BC002642 |
| Gene Symbol | CTSS |
| Gene ID (NCBI) | 1520 |
| RRID | AB_3745227 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P25774 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Cathepsin S (CTSS) is a cysteine protease that plays an important role in extracellular matrix degradation and remodeling, antigen presentation, inflammation, and angiogenesis; it has been identified as a radiation response gene. In malignant tumors, CTSS induces tumor proliferation, invasion and metastasis through various mechanisms. CTSS proteins could be detected in two forms, pro-CTSS (35-37 kDa) and active CTSS (25 kDa) (PMID: 30006610, PMID: 34208434). And in this publication, it was also reporeted that active CTSS was expressed at higher levels than pro-CTSS in the lysate (PMID: 34208434).





