Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, PC-3 cells, mouse thymus tissue, rat thymus tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human lung cancer tissue, human prostate hyperplasia tissue, human testis tissue, rat colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22104-1-AP targets GSK3B in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, chicken, bovine, hamster, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species |
| Full Name | glycogen synthase kinase 3 beta |
| Calculated Molecular Weight | 433 aa, 48 kDa |
| Observed Molecular Weight | 46-48 kDa |
| GenBank Accession Number | BC000251 |
| Gene Symbol | GSK3B |
| Gene ID (NCBI) | 2932 |
| RRID | AB_2878997 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49841 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase.GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.In skeletal muscle, it contributes to INS regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Researches showed that the crystal structure of human GSK3B, expressed in insect cells, at 2.8-angstrom resolution. This antibody recognize the C-terminal of GSK3B.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GSK3B antibody 22104-1-AP | Download protocol |
| IHC protocol for GSK3B antibody 22104-1-AP | Download protocol |
| IP protocol for GSK3B antibody 22104-1-AP | Download protocol |
| WB protocol for GSK3B antibody 22104-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GSK3β antibody (catalog no. 22104-1-AP) has 514 total citations. Citations appear in high-impact journals including Nature, Cell, Signal Transduction and Targeted Therapy, Molecular Cancer, Cell Metabolism, Nature Communications, Hepatology, Journal of Experimental & Clinical Cancer Research, Advanced Science, Cell Death & Differentiation, Cancer Letters, Oncogene, and Phytomedicine. Research fields span oncology (Wnt/β-catenin signaling, tumorigenesis, metastasis), metabolism (diabetes, obesity), neurology (Alzheimer's, stroke), fibrosis, and immunology, with Western blot as the dominant application.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Serine/threonine/tyrosine kinase 1 drives pancreatic carcinogenesis via GSK3β sequestration-mediated Wnt/β-catenin pathway hyperactivation. | ||
Signal Transduct Target Ther B-lymphoid tyrosine kinase-mediated FAM83A phosphorylation elevates pancreatic tumorigenesis through interacting with β-catenin | ||
J Hematol Oncol Exosomes released by hepatocarcinoma cells endow adipocytes with tumor-promoting properties. | ||
Cell QKI shuttles internal m7G-modified transcripts into stress granules and modulates mRNA metabolism | ||
Mol Cancer Hypoxia downregulated miR-4521 suppresses gastric carcinoma progression through regulation of IGF2 and FOXM1. |
Reviews
What customers say
The single review for this product rates it 4 out of 5 stars. The reviewer used it for Western Blot on HEK293T lysates at a 1:1000 dilution, with 5% BSA blocking and an overnight incubation at 4°C, followed by an anti-rabbit HRP secondary at 1:10,000 for one hour at room temperature. The protocol produced clear results, indicating reliable performance under standard WB conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tom (Verified Customer) (12-15-2020) | HEK293 lysates - 10ug total protein. Blocked in 5% BSA before primary antibody (1:1000) overnight at 4 degrees. Anti-rabbit HRP (1:10,000) for 1 hour at RT.
 |
